SimulationCraft 1015-01

for World of Warcraft 10.2.0.52038 PTR (hotfix 2023-11-03/52038, git build f486e91d50)

Current simulator hotfixes

Demon Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-10-23 Manually set secondary Felblade level requirement.
Felblade spell_level 16.00 50.00
2023-05-28 Manually set Consume Soul Fragment (Greater) travel speed.
Consume Soul prj_speed 25.00 0.00

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
Adjust bear thrash periodic damage spell level requirement
Thrash spell_level 11.00 18.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-05-16 Base value of Frost aura's effect 191124 is truncated.
Frost Mage (effect#5) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191122 is truncated.
Frost Mage (effect#3) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 191121 is truncated.
Frost Mage (effect#2) base_value 9.00 9.20
2023-05-16 Base value of Frost aura's effect 179703 is truncated.
Frost Mage (effect#1) base_value 9.00 9.20
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2023-01-08 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Created with Highcharts 4.2.3 Damage per Second(Click title for burst)202,580197,642187,914185,723185,442183,093181,346470 T31_4p460 T31_4p447+470 2p_2p470 T31_2p447+460 2p_2p460 T31_2p447 T30 4p
Created with Highcharts 4.2.3 Damage Taken per Second(Click title for burst)3,9033,8843,8443,8123,8113,7643,707470 T31_2p470 T31_4p460 T31_2p460 T31_4p447+470 2p_2p447+460 2p_2p447 T30 4p

Additional Raid Information

447 T30 4p : 181346 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
181346.1 181346.1 90.6 / 0.050% 25965.6 / 14.3% 14674.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.0 12.0 Astral Power 0.00% 64.6 100.1% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447 T30 4p 181346
Astral Smolder 9528 5.3% 60.1 4.91s 47545 0 Periodic 112.7 25355 0 25355 0.0% 75.1%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 60.07 0.00 112.65 112.65 43.73 0.0000 2.0000 2856143.25 2856143.25 0.00% 12676.90 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 112.65 69 158 25354.54 7748 91735 25369.17 18878 33263 2856143 2856143 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5147) 0.0% (2.8%) 8.5 32.96s 181967 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 8928 2.8% 148.5 1.79s 10404 7983 Direct 147.6 8240 16455 10469 27.1%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.55 147.63 0.00 0.00 0.00 1.3033 0.0000 1545524.73 1545524.73 0.00% 7982.88 7982.88
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.87% 107.58 21 305 8239.56 5451 14396 8233.08 7222 9830 886387 886387 0.00%
crit 27.13% 40.06 4 112 16455.05 10715 28791 16443.81 14099 20546 659138 659138 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.145
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16099.94
Hungering Shadowflame 3014 1.7% 17.1 17.03s 52845 0 Direct 17.1 41505 83254 52851 27.2%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.13 17.13 0.00 0.00 0.00 0.0000 0.0000 905407.83 905407.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.82% 12.48 2 27 41504.98 27597 160192 41324.86 27693 102953 517829 517829 0.00%
crit 27.18% 4.66 0 15 83254.49 55195 320384 82263.88 0 320384 387578 387578 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2875 1.6% 33.9 8.73s 25445 0 Direct 33.8 20058 40087 25513 27.2%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.91 33.82 0.00 0.00 0.00 0.0000 0.0000 862822.07 862822.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.77% 24.61 8 46 20058.13 19533 22677 20057.51 19732 20878 493609 493609 0.00%
crit 27.23% 9.21 1 23 40086.50 39067 45353 40088.34 39067 44653 369213 369213 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 11965 6.6% 14.3 21.63s 250144 256280 Direct 14.3 9046 18412 12315 34.9%
Periodic 307.6 8099 16752 11095 34.6% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 307.56 307.56 13.34 0.9761 0.9717 3588940.74 3588940.74 0.00% 11471.62 256279.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.10% 9.34 2 16 9046.18 6121 16847 9039.06 7711 11230 84499 84499 0.00%
crit 34.90% 5.01 0 13 18411.55 12241 32797 18361.47 0 28867 92183 92183 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.38% 201.08 134 267 8099.24 212 14880 8101.02 7670 8679 1628621 1628621 0.00%
crit 34.62% 106.47 65 158 16751.67 1636 29759 16758.90 15564 18155 1783637 1783637 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.60
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:12.74
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16141) 0.0% (8.9%) 16.9 18.04s 285736 237163

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.94 0.00 0.00 0.00 0.00 1.2048 0.0000 0.00 0.00 0.00% 237163.38 237163.38

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 5815 3.2% 5.3 63.58s 331692 177524 Direct 5.2 229419 457864 333749 45.7%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.27 5.24 0.00 0.00 0.00 1.8686 0.0000 1749326.13 1749326.13 0.00% 177524.47 177524.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.34% 2.85 0 6 229419.48 151844 396596 225216.66 0 386221 653465 653465 0.00%
crit 45.66% 2.39 0 6 457863.63 303688 794337 437007.90 0 733860 1095861 1095861 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.34
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4437 2.4% 6.0 53.85s 222031 294304 Direct 5.9 147455 309449 223554 47.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.99 5.95 0.00 0.00 0.00 0.7545 0.0000 1329667.52 1329667.52 0.00% 294304.45 294304.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.03% 3.15 0 7 147455.23 80023 229911 145431.37 0 226744 465122 465122 0.00%
crit 46.97% 2.79 0 7 309449.46 160047 459822 305150.33 0 453487 864545 864545 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [S]:6.01
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 5889 3.2% 5.7 57.62s 310230 251172 Direct 5.6 203645 408790 312038 52.8%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2352 0.0000 1762222.49 1762222.49 0.00% 251171.96 251171.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 47.16% 2.66 0 7 203644.52 115034 329850 198092.57 0 317367 542382 542382 0.00%
crit 52.84% 2.98 0 7 408789.72 232768 661948 402906.62 0 628104 1219841 1219841 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [T]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (24829) 0.0% (13.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 5428 3.0% 74.4 4.00s 21893 0 Direct 74.2 14947 31099 21951 43.4%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.40 74.20 0.00 0.00 0.00 0.0000 0.0000 1628859.44 1628859.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.64% 42.03 18 76 14947.08 9674 29152 14948.02 13263 17344 628176 628176 0.00%
crit 43.36% 32.18 12 55 31098.79 19349 58304 31110.11 27286 36472 1000683 1000683 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 5436 3.0% 74.6 4.03s 21859 0 Direct 74.4 14927 31056 21915 43.3%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 74.63 74.44 0.00 0.00 0.00 0.0000 0.0000 1631341.91 1631341.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.67% 42.19 15 75 14927.05 9674 29152 14927.31 13159 16968 629699 629699 0.00%
crit 43.33% 32.25 10 57 31055.51 19349 58304 31064.25 27286 35904 1001643 1001643 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 3833 2.1% 6.2 49.00s 185197 0 Direct 6.2 125856 262573 185740 43.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 6.19 0.00 0.00 0.00 0.0000 0.0000 1150217.87 1150217.87 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.19% 3.48 0 8 125856.32 81406 235254 124730.62 0 226624 437913 437913 0.00%
crit 43.81% 2.71 0 8 262573.16 162812 490604 254589.56 0 444866 712305 712305 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Crashing Star 10133 5.6% 37.3 7.90s 81590 0 Direct 37.2 55728 115971 81809 43.3%

Stats Details: Crashing Star

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.27 37.17 0.00 0.00 0.00 0.0000 0.0000 3040604.79 3040604.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.70% 21.07 3 42 55727.97 36102 108786 55738.13 47217 68060 1174443 1174443 0.00%
crit 43.30% 16.09 1 36 115971.34 72204 217572 116005.89 92853 155948 1866162 1866162 0.00%

Action Details: Crashing Star

  • id:408310
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:5.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:408310
  • name:Crashing Star
  • school:astral
  • tooltip:
  • description:{$@spelldesc405511=Shooting Stars has a {$s1=20}% chance to instead call down a Crashing Star, dealing {$408310s1=0} Astral damage to the target and generating {$=}{{$408310m2=50}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 2279 1.3% 22.9 11.27s 30018 25040 Direct 23.9 20626 41000 28762 39.9%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 22.89 23.89 0.00 0.00 0.00 1.1988 0.0000 687091.33 687091.33 0.00% 25039.77 25039.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 60.07% 14.35 3 28 20626.50 16572 36161 20605.31 18665 23050 295993 295993 0.00%
crit 39.93% 9.54 0 23 40999.65 33144 69936 40938.97 0 49634 391099 391099 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [N]:22.97
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 55462 (74971) 30.6% (41.3%) 113.9 2.63s 197381 198021 Direct 113.6 (151.1) 101661 210087 146314 41.2% (41.7%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 113.86 113.62 0.00 0.00 0.00 0.9968 0.0000 16624632.45 16624632.45 0.00% 198020.96 198020.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.81% 66.83 39 103 101661.14 65372 193113 101675.08 94259 112128 6793594 6793594 0.00%
crit 41.19% 46.80 24 73 210086.53 132278 386226 210209.69 186613 233903 9831038 9831038 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [P]:83.91
  • if_expr:variable.starsurge_condition1
    st
    [W]:29.95
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 19510 10.8% 37.6 7.92s 155489 0 Direct 37.4 106962 220534 156235 43.4%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.62 37.44 0.00 0.00 0.00 0.0000 0.0000 5848964.06 5848964.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.61% 21.19 5 40 106962.31 77064 201930 106974.06 91924 127109 2266925 2266925 0.00%
crit 43.39% 16.24 3 35 220534.42 154129 403859 220628.54 182231 271871 3582040 3582040 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 11745 6.5% 17.4 18.04s 202512 206356 Direct 17.4 8807 17785 12172 37.5%
Periodic 308.5 7796 15792 10738 36.8% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 308.52 308.52 16.40 0.9814 0.9717 3524564.30 3524564.30 0.00% 11123.03 206356.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 62.53% 10.88 2 20 8807.49 5564 15548 8799.62 7553 10720 95849 95849 0.00%
crit 37.47% 6.52 0 15 17785.25 11128 30777 17777.78 0 24699 115994 115994 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 63.21% 195.01 134 263 7795.75 27 13527 7794.32 7392 8248 1520263 1520263 0.00%
crit 36.79% 113.51 70 162 15791.83 201 27054 15792.07 14893 17012 1792458 1792458 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.84
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [Q]:15.56
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3199) 0.0% (1.8%) 8.5 32.20s 113357 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1667 0.9% 8.5 32.20s 59044 0 Direct 8.5 46333 92580 59046 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.00 0.0000 0.0000 500360.37 500360.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.51% 6.15 0 19 46333.19 45085 52340 46316.05 0 52340 284722 284722 0.00%
crit 27.49% 2.33 0 10 92579.67 90170 104681 84686.32 0 104681 215638 215638 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1533 0.8% 16.4 15.57s 28017 0 Direct 16.4 22034 44037 28016 27.2%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 0.00 0.0000 0.0000 460260.76 460260.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.81% 11.96 1 33 22034.49 21453 24905 22033.86 21453 23794 263559 263559 0.00%
crit 27.19% 4.47 0 18 44036.57 42906 49811 43337.49 0 49811 196701 196701 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 15652 8.6% 110.7 2.65s 42381 44043 Direct 110.4 28872 58676 42517 45.8%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 110.74 110.39 0.00 0.00 0.00 0.9623 0.0000 4693442.78 4693442.78 0.00% 44042.59 44042.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.22% 59.85 33 90 28872.06 12632 50924 28870.52 24783 32012 1728057 1728057 0.00%
crit 45.78% 50.54 25 77 58676.41 25264 103396 58673.83 52649 64915 2965386 2965386 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [O]:1.74
  • if_expr:variable.enter_eclipse
    st
    [X]:107.28

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447 T30 4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 180.93s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [L]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 75.37s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.75 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447 T30 4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.75
Elemental Potion of Ultimate Power 1.5 307.59s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.49
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 5.5 53.03s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.51 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [M]:5.51
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.9 2.5 35.3s 29.5s 8.4s 24.98% 29.18% 2.5 (16.8) 8.7

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 53.1s
  • trigger_min/max:0.0s / 52.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.9s
  • uptime_min/max:21.94% / 31.84%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.92%
  • balance_of_all_things_arcane_2:2.96%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.01%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.08%
  • balance_of_all_things_arcane_7:3.43%
  • balance_of_all_things_arcane_8:3.56%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.2 1.7 16.9s 15.5s 8.2s 49.61% 53.45% 1.7 (8.0) 17.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.6s
  • trigger_min/max:0.9s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.7s
  • uptime_min/max:44.52% / 53.67%

Stack Uptimes

  • balance_of_all_things_nature_1:5.88%
  • balance_of_all_things_nature_2:5.96%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.14%
  • balance_of_all_things_nature_5:6.23%
  • balance_of_all_things_nature_6:6.32%
  • balance_of_all_things_nature_7:6.44%
  • balance_of_all_things_nature_8:6.58%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.7s 70.7s 10.8s 9.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 347.7s
  • trigger_min/max:12.0s / 347.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.35%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.89%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.90%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.91%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.1s 70.7s 45.7s 33.21% 0.00% 69.4 (69.4) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 347.7s
  • trigger_min/max:12.0s / 347.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 344.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.21%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.2s 70.2s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.6s
  • trigger_min/max:12.0s / 338.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.85%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.6s 70.2s 45.7s 33.46% 0.00% 69.8 (69.8) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 353.3s
  • trigger_min/max:12.0s / 338.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 346.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.46%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.3s 70.3s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 345.0s
  • trigger_min/max:12.0s / 345.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.10%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.2s 70.3s 45.6s 33.34% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 351.4s
  • trigger_min/max:12.0s / 345.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 312.4s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.34%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.50% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.50%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.2s 58.4s 50.2s 80.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 356.0s
  • trigger_min/max:15.0s / 320.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.5s
  • uptime_min/max:45.15% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.21%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.2s 32.1s 41.2s 57.02% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 286.4s
  • trigger_min/max:0.0s / 150.7s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 261.2s
  • uptime_min/max:20.86% / 97.71%

Stack Uptimes

  • denizen_of_the_dream_1:38.47%
  • denizen_of_the_dream_2:14.28%
  • denizen_of_the_dream_3:3.53%
  • denizen_of_the_dream_4:0.64%
  • denizen_of_the_dream_5:0.09%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Lunar) 7.1 2.3 45.8s 37.5s 20.7s 49.07% 52.77% 2.3 (2.3) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:0.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 56.1s
  • uptime_min/max:43.86% / 59.70%

Stack Uptimes

  • eclipse_lunar_1:49.07%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.3 4.5 23.4s 17.3s 20.6s 91.32% 94.54% 4.5 (4.5) 12.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 62.4s
  • trigger_min/max:0.9s / 56.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 60.6s
  • uptime_min/max:84.30% / 94.62%

Stack Uptimes

  • eclipse_solar_1:91.32%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.3s 307.3s 27.3s 13.27% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 329.6s
  • trigger_min/max:300.0s / 329.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.90% / 18.07%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.27%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.8s 32.1s 24.9s 43.23% 43.17% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 206.2s
  • trigger_min/max:0.0s / 150.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 139.1s
  • uptime_min/max:13.90% / 82.49%

Stack Uptimes

  • friend_of_the_fae_1:43.23%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 45.5s 45.5s 20.3s 48.04% 50.99% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.33% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.04%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.8s 99.8s 19.5s 23.24% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 128.4s
  • trigger_min/max:90.0s / 128.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.17% / 26.26%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.4 0.0 21.5s 21.5s 5.9s 24.44% 0.00% 0.0 (0.0) 12.1

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.9s / 62.8s
  • trigger_min/max:12.9s / 62.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.19% / 29.17%

Stack Uptimes

  • natures_grace_1:24.44%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.53% / 21.05%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.5 0.1 74.2s 67.9s 7.8s 6.34% 7.23% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 355.0s
  • trigger_min/max:0.0s / 355.0s
  • trigger_pct:15.13%
  • duration_min/max:0.0s / 28.6s
  • uptime_min/max:0.00% / 28.58%

Stack Uptimes

  • owlkin_frenzy_1:6.34%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.0 106.8 39.4s 39.4s 35.3s 94.45% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.5s / 53.7s
  • trigger_min/max:24.5s / 53.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.2s
  • uptime_min/max:90.96% / 97.17%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.76%
  • primordial_arcanic_pulsar_8:5.47%
  • primordial_arcanic_pulsar_12:6.94%
  • primordial_arcanic_pulsar_16:7.97%
  • primordial_arcanic_pulsar_20:6.56%
  • primordial_arcanic_pulsar_24:6.28%
  • primordial_arcanic_pulsar_28:7.97%
  • primordial_arcanic_pulsar_32:7.29%
  • primordial_arcanic_pulsar_36:6.85%
  • primordial_arcanic_pulsar_40:7.10%
  • primordial_arcanic_pulsar_44:6.73%
  • primordial_arcanic_pulsar_48:6.83%
  • primordial_arcanic_pulsar_52:6.92%
  • primordial_arcanic_pulsar_56:6.77%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 3.6 16.7s 14.5s 6.3s 38.78% 38.80% 3.6 (3.6) 18.1

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.7s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.8s
  • uptime_min/max:35.94% / 42.06%

Stack Uptimes

  • solstice_1:38.78%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 93.1 14.7s 2.6s 14.0s 97.11% 0.00% 51.9 (51.9) 7.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 21.1s
  • trigger_min/max:0.8s / 11.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:91.97% / 99.36%

Stack Uptimes

  • starlord_1:9.95%
  • starlord_2:15.44%
  • starlord_3:71.71%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.17% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 325.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 351.5s
  • uptime_min/max:68.57% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.17%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.2s 45.6s 16.5s 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 221.6s
  • trigger_min/max:0.0s / 208.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 73.7s
  • uptime_min/max:4.76% / 60.79%

Stack Uptimes

  • wafting_devotion_1:23.62%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 5.5 0.0 53.2s 53.2s 22.0s 40.26% 38.85% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 115.3s
  • trigger_min/max:45.0s / 115.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:26.38% / 51.55%

Stack Uptimes

  • warrior_of_elune_1:22.70%
  • warrior_of_elune_2:5.00%
  • warrior_of_elune_3:12.57%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 22.0 32.1s 0.0s 150.7s
Primordial Arcanic Pulsar 7.1 6.0 9.0 41.2s 29.8s 53.4s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.14% 0.00% 2.38% 0.5s 0.0s 4.1s
Astral Smolder 75.25% 52.54% 92.02% 13.8s 0.0s 134.0s
Incarnation (Total) 48.04% 43.33% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 27.79% 25.11% 30.37% 11.8s 0.0s 12.0s
Lunar Eclipse Only 1.03% 0.51% 8.22% 1.3s 0.0s 15.0s
Solar Eclipse Only 43.28% 33.40% 49.83% 12.2s 0.0s 15.0s
No Eclipse 7.61% 4.27% 10.52% 1.9s 0.0s 4.7s
Friend of the Fae 43.23% 13.90% 82.49% 24.9s 0.0s 139.1s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune12.8630.00070.33371.55936.872118.529
Full Moon
New Moon
Half Moon
0.3000.00024.7755.1043.84629.064

Eclipse Utilization

NoneSolarLunarBoth
Wrath6.475.9%52.4348.2%0.300.3%49.5445.6%
Starfire22.6194.6%0.000.0%1.004.2%0.281.2%
Starsurge0.000.0%46.0240.4%0.540.5%67.2959.1%
New Moon0.020.3%0.132.2%0.000.0%5.8497.5%
Half Moon0.000.0%0.234.1%0.000.0%5.4495.8%
Full Moon0.282.4%3.0926.9%0.090.8%8.0269.8%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447 T30 4p
Nature's BalanceAstral Power99.60199.005.53%2.000.200.10%
Crashing StarAstral Power37.27185.935.17%4.990.400.22%
Full MoonAstral Power5.27263.137.31%49.900.550.21%
Half MoonAstral Power5.68136.333.79%24.000.010.01%
MoonfireAstral Power14.3586.012.39%6.000.070.08%
New MoonAstral Power5.9971.862.00%12.000.000.00%
Orbit BreakerAstral Power6.21185.005.14%29.791.320.71%
Shooting Stars (Moonfire)Astral Power74.40148.544.13%2.000.260.18%
Shooting Stars (Sunfire)Astral Power74.63149.004.14%2.000.260.17%
StarfireAstral Power23.89349.289.71%14.623.150.89%
SunfireAstral Power17.40104.352.90%6.000.070.06%
WrathAstral Power110.741719.0447.78%15.520.250.01%
Usage Type Count Total Tot% Avg RPE APR
447 T30 4p
StarsurgeAstral Power 114.043606.79100.00%31.6331.686230.91
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 678140.0 3133.89 3706.92 1372361.1 506054.7 -264800.9 678140.0
Astral Power 70.0 11.98 11.99 6.5 26.3 0.0 100.0

Statistics & Data Analysis

Fight Length
447 T30 4p Fight Length
Count 20646
Mean 300.31
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 19.98%
Standard Deviation 34.5479
5th Percentile 246.19
95th Percentile 354.05
( 95th Percentile - 5th Percentile ) 107.86
Mean Distribution
Standard Deviation 0.2404
95.00% Confidence Interval ( 299.84 - 300.78 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 509
0.1% Error 50841
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1019
DPS
447 T30 4p Damage Per Second
Count 20646
Mean 181346.07
Minimum 159575.41
Maximum 209498.30
Spread ( max - min ) 49922.89
Range [ ( max - min ) / 2 * 100% ] 13.76%
Standard Deviation 6638.7287
5th Percentile 170977.21
95th Percentile 192652.82
( 95th Percentile - 5th Percentile ) 21675.62
Mean Distribution
Standard Deviation 46.2027
95.00% Confidence Interval ( 181255.51 - 181436.62 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5149
0.1 Scale Factor Error with Delta=300 376231
0.05 Scale Factor Error with Delta=300 1504921
0.01 Scale Factor Error with Delta=300 37623008
Priority Target DPS
447 T30 4p Priority Target Damage Per Second
Count 20646
Mean 181346.07
Minimum 159575.41
Maximum 209498.30
Spread ( max - min ) 49922.89
Range [ ( max - min ) / 2 * 100% ] 13.76%
Standard Deviation 6638.7287
5th Percentile 170977.21
95th Percentile 192652.82
( 95th Percentile - 5th Percentile ) 21675.62
Mean Distribution
Standard Deviation 46.2027
95.00% Confidence Interval ( 181255.51 - 181436.62 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5149
0.1 Scale Factor Error with Delta=300 376231
0.05 Scale Factor Error with Delta=300 1504921
0.01 Scale Factor Error with Delta=300 37623008
DPS(e)
447 T30 4p Damage Per Second (Effective)
Count 20646
Mean 181346.07
Minimum 159575.41
Maximum 209498.30
Spread ( max - min ) 49922.89
Range [ ( max - min ) / 2 * 100% ] 13.76%
Damage
447 T30 4p Damage
Count 20646
Mean 52844870.08
Minimum 39095531.71
Maximum 67475529.94
Spread ( max - min ) 28379998.23
Range [ ( max - min ) / 2 * 100% ] 26.85%
DTPS
447 T30 4p Damage Taken Per Second
Count 20646
Mean 3707.19
Minimum 908.91
Maximum 7388.86
Spread ( max - min ) 6479.96
Range [ ( max - min ) / 2 * 100% ] 87.40%
HPS
447 T30 4p Healing Per Second
Count 20646
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447 T30 4p Healing Per Second (Effective)
Count 20646
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447 T30 4p Heal
Count 20646
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447 T30 4p Healing Taken Per Second
Count 20646
Mean 3126.76
Minimum 545.00
Maximum 6479.84
Spread ( max - min ) 5934.84
Range [ ( max - min ) / 2 * 100% ] 94.90%
TMI
447 T30 4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447 T30 4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447 T30 4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.49 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.75 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.84 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.60 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
0.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
L 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
M 5.51 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
N 22.97 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
O 1.74 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
P 83.91 starsurge,if=variable.starsurge_condition1
Q 15.56 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
R 12.74 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
S 6.01 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
T 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.34 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
V 12.41 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
W 29.95 starsurge,if=variable.starsurge_condition2
X 107.28 wrath
Y 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLDEPPPSTPUPXXWXXQWXVPPRPXXXXWXXWSMWXWXXVPPPPQPXXPXXXRWXXWVPNNPPXQXPXXXXWXVPPOORXPTPQUWMXXPPXNNPPXXPRXQVPXXFPXNNPPXXXVPPQXPRXXXOWESTVPPXMPXXXQWWNNXWRXPPXPXXXXWQNNWVXPXPPRXXXXWXQVPPPUMSXWWNNPXRXVPPQXPXXFXLPPTUVPPPXXRQXWPXXWVPXXEPPSXXWXXWQXVPPPRMXXXXWWXNNVPPXPQTPXPXXRXWXVPNNPXPQXPXWXXVPXPNNPRXPQXXXMPFPXXPUPPSPRQXTPNNPPXPXXXXXWWXQDNNPPKEPXXXXWXXWWQUPPMPRSWX

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447 T30 4p 50.0/100: 50% astral_power
Pre precombat 1 food 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447 T30 4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447 T30 4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:00.942 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:01.883 st L incarnation_chosen_of_elune Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:01.883 default D potion Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:01.883 default E use_items Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:01.883 st P starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:02.739 st P starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.561 st P starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:04.355 st S new_moon Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.109 st T half_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.126 st P starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:06.892 st U full_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.420 st P starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:09.187 st X wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:09.952 st X wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:10.717 st W starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.482 st X wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:12.247 st X wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.012 st Q sunfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:13.778 st W starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.546 st X wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:15.310 st V cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:15.310 st P starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.168 st P starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:16.991 st R moonfire Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:17.784 st P starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.578 st X wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.345 st X wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.110 st X wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:20.876 st X wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.642 st W starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.409 st X wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.175 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.939 st W starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.705 st S new_moon Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.617 st M warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.617 st W starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.384 st X wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.149 st W starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.914 st X wrath Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.677 st X wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.442 st V cancel_buff Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.442 st P starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.297 st P starsurge Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.058 st P starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.812 st P starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.566 st Q sunfire Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:33.321 st P starsurge Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.078 st X wrath Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:34.832 st X wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
0:35.586 st P starsurge Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:36.339 st X wrath Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:37.094 st X wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:37.849 st X wrath Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:38.602 st R moonfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:39.356 st W starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:40.111 st X wrath Fluffy_Pillow 45.0/100: 45% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:41.029 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:41.949 st W starsurge Fluffy_Pillow 87.0/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:42.867 st V cancel_buff Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:42.867 st P starsurge Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:43.896 st N starfire Fluffy_Pillow 33.0/100: 33% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:44.885 st N starfire Fluffy_Pillow 51.8/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:45.874 st P starsurge Fluffy_Pillow 70.6/100: 71% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:46.943 st P starsurge Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:47.972 st X wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:48.890 st Q sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:49.810 st X wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:50.727 st P starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:51.737 st X wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:52.744 st X wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:53.754 st X wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:54.762 st X wrath Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:55.771 st W starsurge Fluffy_Pillow 85.6/100: 86% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:56.781 st X wrath Fluffy_Pillow 49.6/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:57.792 st V cancel_buff Fluffy_Pillow 72.6/100: 73% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:57.792 st P starsurge Fluffy_Pillow 72.6/100: 73% astral_power eclipse_solar, primordial_arcanic_pulsar(48), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
0:58.922 st P starsurge Fluffy_Pillow 36.6/100: 37% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:00.008 st O wrath Fluffy_Pillow 2.6/100: 3% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:00.960 st O wrath Fluffy_Pillow 12.6/100: 13% astral_power natures_grace, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:01.911 st R moonfire Fluffy_Pillow 22.6/100: 23% astral_power balance_of_all_things_arcane(8), eclipse_lunar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:02.864 st X wrath Fluffy_Pillow 28.6/100: 29% astral_power balance_of_all_things_arcane(8), eclipse_lunar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:03.816 st P starsurge Fluffy_Pillow 40.6/100: 41% astral_power balance_of_all_things_arcane(7), eclipse_lunar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:04.847 st T half_moon Fluffy_Pillow 4.6/100: 5% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:06.051 st P starsurge Fluffy_Pillow 32.6/100: 33% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:07.044 st Q sunfire Fluffy_Pillow 4.6/100: 5% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:08.037 st U full_moon Fluffy_Pillow 14.6/100: 15% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:10.021 st W starsurge Fluffy_Pillow 75.6/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.015 st M warrior_of_elune Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.015 st X wrath Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:12.010 st X wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:13.005 st P starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:14.117 st P starsurge Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:15.187 st X wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:16.217 st N starfire Fluffy_Pillow 39.6/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:17.246 st N starfire Fluffy_Pillow 56.4/100: 56% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:18.278 st P starsurge Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:19.306 st P starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:20.300 st X wrath Fluffy_Pillow 8.2/100: 8% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:21.293 st X wrath Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:22.286 st P starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:23.379 st R moonfire Fluffy_Pillow 20.2/100: 20% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:24.472 st X wrath Fluffy_Pillow 28.2/100: 28% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:25.563 st Q sunfire Fluffy_Pillow 44.2/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:26.656 st V cancel_buff Fluffy_Pillow 50.2/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:26.656 st P starsurge Fluffy_Pillow 50.2/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:27.880 st X wrath Fluffy_Pillow 16.2/100: 16% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:29.057 st X wrath Fluffy_Pillow 32.2/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.233 default F natures_vigil 447 T30 4p 50.2/100: 50% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.233 st P starsurge Fluffy_Pillow 50.2/100: 50% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:31.409 st X wrath Fluffy_Pillow 14.2/100: 14% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:32.540 st N starfire Fluffy_Pillow 24.2/100: 24% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:33.572 st N starfire Fluffy_Pillow 77.0/100: 77% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:35.115 st P starsurge Fluffy_Pillow 94.0/100: 94% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:36.146 st P starsurge Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:37.138 st X wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:38.133 st X wrath Fluffy_Pillow 49.0/100: 49% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:39.126 st X wrath Fluffy_Pillow 67.0/100: 67% astral_power natures_vigil, balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:40.217 st V cancel_buff Fluffy_Pillow 85.0/100: 85% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:40.217 st P starsurge Fluffy_Pillow 85.0/100: 85% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:41.440 st P starsurge Fluffy_Pillow 53.0/100: 53% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:42.617 st Q sunfire Fluffy_Pillow 19.0/100: 19% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:43.748 st X wrath Fluffy_Pillow 27.0/100: 27% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:44.880 st P starsurge Fluffy_Pillow 45.0/100: 45% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
1:46.013 st R moonfire Fluffy_Pillow 11.0/100: 11% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
1:47.106 st X wrath Fluffy_Pillow 17.0/100: 17% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
1:48.199 st X wrath Fluffy_Pillow 37.0/100: 37% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
1:49.291 st X wrath Fluffy_Pillow 53.0/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
1:50.383 st O wrath Fluffy_Pillow 63.0/100: 63% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
1:51.377 st W starsurge Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_arcane(8), denizen_of_the_dream, eclipse_lunar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak
1:52.370 default E use_items Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak
1:52.370 st S new_moon Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:53.125 st T half_moon Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(100)
1:54.328 st V cancel_buff Fluffy_Pillow 79.0/100: 79% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(95)
1:54.328 st P starsurge Fluffy_Pillow 79.0/100: 79% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(95)
1:55.340 st P starsurge Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(90)
1:56.312 st X wrath Fluffy_Pillow 27.0/100: 27% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(85)
1:57.344 st M warrior_of_elune Fluffy_Pillow 47.0/100: 47% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
1:57.344 st P starsurge Fluffy_Pillow 47.0/100: 47% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(80)
1:58.376 st X wrath Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(70)
1:59.369 st X wrath Fluffy_Pillow 37.0/100: 37% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
2:00.362 st X wrath Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
2:01.356 st Q sunfire Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(60)
2:02.351 st W starsurge Fluffy_Pillow 77.0/100: 77% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
2:03.346 st W starsurge Fluffy_Pillow 51.0/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(50)
2:04.340 st N starfire Fluffy_Pillow 27.0/100: 27% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(45)
2:05.258 st N starfire Fluffy_Pillow 45.8/100: 46% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(40)
2:06.177 st X wrath Fluffy_Pillow 68.6/100: 69% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(35)
2:07.094 st W starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(30)
2:08.014 st R moonfire Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(25)
2:08.932 st X wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(20)
2:09.849 st P starsurge Fluffy_Pillow 86.6/100: 87% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(15)
2:10.980 st P starsurge Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(10)
2:12.065 st X wrath Fluffy_Pillow 20.6/100: 21% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, kindled_soul(5)
2:13.113 st P starsurge Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:14.161 st X wrath Fluffy_Pillow 0.6/100: 1% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:15.170 st X wrath Fluffy_Pillow 18.6/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:16.178 st X wrath Fluffy_Pillow 34.6/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:17.188 st X wrath Fluffy_Pillow 50.6/100: 51% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:18.198 st W starsurge Fluffy_Pillow 68.6/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:19.207 st Q sunfire Fluffy_Pillow 34.6/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:20.298 st N starfire Fluffy_Pillow 40.6/100: 41% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:21.292 st N starfire Fluffy_Pillow 59.4/100: 59% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:22.781 st W starsurge Fluffy_Pillow 71.4/100: 71% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:23.773 st V cancel_buff Fluffy_Pillow 35.4/100: 35% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:23.773 st X wrath Fluffy_Pillow 35.4/100: 35% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_pip_static, undulating_sporecloak
2:24.886 st P starsurge Fluffy_Pillow 53.4/100: 53% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_pip_static, undulating_sporecloak
2:25.998 st X wrath Fluffy_Pillow 17.4/100: 17% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak
2:27.067 st P starsurge Fluffy_Pillow 39.4/100: 39% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak
2:28.243 st P starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak
2:29.373 st R moonfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:30.465 st X wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:31.557 st X wrath Fluffy_Pillow 28.4/100: 28% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
2:32.649 st X wrath Fluffy_Pillow 46.4/100: 46% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
2:33.740 st X wrath Fluffy_Pillow 66.4/100: 66% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:34.831 st W starsurge Fluffy_Pillow 82.4/100: 82% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:35.924 st X wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
2:36.916 st Q sunfire Fluffy_Pillow 73.4/100: 73% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
2:37.911 st V cancel_buff Fluffy_Pillow 81.4/100: 81% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:37.911 st P starsurge Fluffy_Pillow 81.4/100: 81% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
2:39.023 st P starsurge Fluffy_Pillow 57.4/100: 57% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
2:40.091 st P starsurge Fluffy_Pillow 29.4/100: 29% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:41.121 st U full_moon Fluffy_Pillow 8.4/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:43.102 st M warrior_of_elune Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:43.102 st S new_moon Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:43.858 st X wrath Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:44.852 st W starsurge Fluffy_Pillow 88.4/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:45.846 st W starsurge Fluffy_Pillow 62.4/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:46.839 st N starfire Fluffy_Pillow 34.4/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:47.832 st N starfire Fluffy_Pillow 56.2/100: 56% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:48.825 st P starsurge Fluffy_Pillow 77.0/100: 77% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:49.818 st X wrath Fluffy_Pillow 43.0/100: 43% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:50.812 st R moonfire Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
2:51.806 st X wrath Fluffy_Pillow 69.0/100: 69% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static
2:52.800 st V cancel_buff Fluffy_Pillow 85.0/100: 85% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static
2:52.800 st P starsurge Fluffy_Pillow 85.0/100: 85% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static
2:53.914 st P starsurge Fluffy_Pillow 51.0/100: 51% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, best_friends_with_pip, best_friends_with_pip_static
2:55.090 st Q sunfire Fluffy_Pillow 17.0/100: 17% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:56.223 st X wrath Fluffy_Pillow 27.0/100: 27% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:57.357 st P starsurge Fluffy_Pillow 45.0/100: 45% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:58.490 st X wrath Fluffy_Pillow 9.0/100: 9% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:59.581 st X wrath Fluffy_Pillow 25.0/100: 25% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
3:00.673 default F natures_vigil 447 T30 4p 43.0/100: 43% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static
3:00.673 st X wrath Fluffy_Pillow 43.0/100: 43% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static
3:01.766 st L incarnation_chosen_of_elune Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static
3:01.883 st P starsurge Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static
3:02.877 st P starsurge Fluffy_Pillow 31.0/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static
3:03.870 st T half_moon Fluffy_Pillow 7.0/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static
3:05.194 st U full_moon Fluffy_Pillow 37.0/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
3:07.179 st V cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:07.179 st P starsurge Fluffy_Pillow 91.0/100: 91% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:08.292 st P starsurge Fluffy_Pillow 63.0/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:09.361 st P starsurge Fluffy_Pillow 37.0/100: 37% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:10.390 st X wrath Fluffy_Pillow 9.0/100: 9% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:11.382 st X wrath Fluffy_Pillow 27.0/100: 27% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:12.374 st R moonfire Fluffy_Pillow 47.0/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:13.369 st Q sunfire Fluffy_Pillow 53.0/100: 53% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:14.364 st X wrath Fluffy_Pillow 59.0/100: 59% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:15.358 st W starsurge Fluffy_Pillow 77.0/100: 77% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:16.350 st P starsurge Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:17.343 st X wrath Fluffy_Pillow 21.0/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:18.338 st X wrath Fluffy_Pillow 41.0/100: 41% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:19.333 st W starsurge Fluffy_Pillow 59.0/100: 59% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.251 st V cancel_buff Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.251 st P starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:21.279 st X wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:22.267 st X wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:23.252 default E use_items Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:23.252 st P starsurge Fluffy_Pillow 49.0/100: 49% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:24.239 st P starsurge Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:25.190 st S new_moon Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
3:25.944 st X wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
3:26.864 st X wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
3:27.780 st W starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
3:28.699 st X wrath Fluffy_Pillow 54.0/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
3:29.617 st X wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
3:30.535 st W starsurge Fluffy_Pillow 92.0/100: 92% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(65)
3:31.455 st Q sunfire Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(60)
3:32.372 st X wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(55)
3:33.292 st V cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:33.292 st P starsurge Fluffy_Pillow 93.0/100: 93% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), best_friends_with_aerwynn_static, wafting_devotion, corrupting_rage, kindled_soul(50)
3:34.319 st P starsurge Fluffy_Pillow 65.0/100: 65% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
3:35.390 st P starsurge Fluffy_Pillow 37.0/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:36.422 st R moonfire Fluffy_Pillow 11.0/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:37.413 st M warrior_of_elune Fluffy_Pillow 19.0/100: 19% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:37.413 st X wrath Fluffy_Pillow 19.0/100: 19% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:38.406 st X wrath Fluffy_Pillow 37.0/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:39.400 st X wrath Fluffy_Pillow 55.0/100: 55% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:40.392 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:41.386 st W starsurge Fluffy_Pillow 87.0/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:42.379 st W starsurge Fluffy_Pillow 61.0/100: 61% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:43.373 st X wrath Fluffy_Pillow 33.0/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
3:44.367 st N starfire Fluffy_Pillow 43.0/100: 43% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:45.359 st N starfire Fluffy_Pillow 61.8/100: 62% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:46.352 st V cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:46.352 st P starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:47.465 st P starsurge Fluffy_Pillow 52.6/100: 53% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, warrior_of_elune, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:48.533 st X wrath Fluffy_Pillow 18.6/100: 19% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:49.564 st P starsurge Fluffy_Pillow 36.6/100: 37% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.517 st Q sunfire Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:51.434 st T half_moon Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:52.655 st P starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:53.572 st X wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:54.489 st P starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_pip, best_friends_with_pip_static, wafting_devotion, corrupting_rage
3:55.407 st X wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.325 st X wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:57.242 st R moonfire Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.160 st X wrath Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.078 st W starsurge Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.996 st X wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.918 st V cancel_buff Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.918 st P starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.947 st N starfire Fluffy_Pillow 27.6/100: 28% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.937 st N starfire Fluffy_Pillow 48.4/100: 48% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:04.418 st P starsurge Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:05.406 st X wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:06.436 st P starsurge Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:07.465 st Q sunfire Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.456 st X wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:09.549 st P starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:10.640 st X wrath Fluffy_Pillow 15.4/100: 15% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:11.731 st W starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:12.822 st X wrath Fluffy_Pillow 2.4/100: 2% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:13.915 st X wrath Fluffy_Pillow 18.4/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:15.007 st V cancel_buff Fluffy_Pillow 38.4/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:15.007 st P starsurge Fluffy_Pillow 38.4/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:16.229 st X wrath Fluffy_Pillow 2.4/100: 2% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:17.406 st P starsurge Fluffy_Pillow 50.4/100: 50% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:18.583 st N starfire Fluffy_Pillow 16.4/100: 16% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:20.279 st N starfire Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_pip_static, corrupting_rage
4:21.821 st P starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_pip_static, corrupting_rage
4:22.851 st R moonfire Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:23.847 st X wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:24.841 st P starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, corrupting_rage
4:25.836 st Q sunfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:26.929 st X wrath Fluffy_Pillow 15.4/100: 15% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:28.021 st X wrath Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:29.113 st X wrath Fluffy_Pillow 61.4/100: 61% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:30.204 st M warrior_of_elune Fluffy_Pillow 79.4/100: 79% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_pip_static, corrupting_rage
4:30.204 st P starsurge Fluffy_Pillow 79.4/100: 79% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:31.427 default F natures_vigil 447 T30 4p 43.4/100: 43% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:31.427 st P starsurge Fluffy_Pillow 43.4/100: 43% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:32.604 st X wrath Fluffy_Pillow 7.4/100: 7% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:33.736 st X wrath Fluffy_Pillow 27.4/100: 27% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:34.869 st P starsurge Fluffy_Pillow 43.4/100: 43% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, corrupting_rage
4:36.001 st U full_moon Fluffy_Pillow 14.4/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:37.986 st P starsurge Fluffy_Pillow 73.4/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:38.977 st P starsurge Fluffy_Pillow 47.4/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:39.970 st S new_moon Fluffy_Pillow 25.4/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:40.723 st P starsurge Fluffy_Pillow 41.4/100: 41% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:41.717 st R moonfire Fluffy_Pillow 15.4/100: 15% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:42.709 st Q sunfire Fluffy_Pillow 23.4/100: 23% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:43.702 st X wrath Fluffy_Pillow 31.4/100: 31% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:44.621 st T half_moon Fluffy_Pillow 47.4/100: 47% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:46.084 st P starsurge Fluffy_Pillow 73.4/100: 73% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:47.111 st N starfire Fluffy_Pillow 47.4/100: 47% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:48.100 st N starfire Fluffy_Pillow 66.2/100: 66% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:49.089 st P starsurge Fluffy_Pillow 83.0/100: 83% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:50.077 st P starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:51.027 st X wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:51.946 st P starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:52.866 st X wrath Fluffy_Pillow 4.0/100: 4% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:53.784 st X wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
4:54.793 st X wrath Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:55.804 st X wrath Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, wafting_devotion
4:56.814 st X wrath Fluffy_Pillow 72.0/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, wafting_devotion
4:57.823 st W starsurge Fluffy_Pillow 92.0/100: 92% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, wafting_devotion
4:58.833 st W starsurge Fluffy_Pillow 56.0/100: 56% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, wafting_devotion
4:59.842 st X wrath Fluffy_Pillow 20.0/100: 20% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
5:00.853 st Q sunfire Fluffy_Pillow 38.0/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
5:01.864 default D potion Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(36), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
5:01.883 st N starfire Fluffy_Pillow 44.0/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(36), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power
5:03.577 st N starfire Fluffy_Pillow 58.0/100: 58% astral_power natures_grace, primordial_arcanic_pulsar(36), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:05.115 st P starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:06.141 st P starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:07.209 st K moonfire Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.240 default E use_items Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power
5:08.240 st P starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:09.270 st X wrath Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:10.362 st X wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:11.457 st X wrath Fluffy_Pillow 53.0/100: 53% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:12.549 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:13.642 st W starsurge Fluffy_Pillow 89.0/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:14.733 st X wrath Fluffy_Pillow 53.0/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:15.825 st X wrath Fluffy_Pillow 71.0/100: 71% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:16.918 st W starsurge Fluffy_Pillow 87.0/100: 87% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:18.011 st W starsurge Fluffy_Pillow 55.0/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:19.104 st Q sunfire Fluffy_Pillow 23.0/100: 23% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:20.096 st U full_moon Fluffy_Pillow 33.0/100: 33% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:21.930 st P starsurge Fluffy_Pillow 87.0/100: 87% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:22.957 st P starsurge Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:23.945 st M warrior_of_elune Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:23.945 st P starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:24.897 st R moonfire Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:25.816 st S new_moon Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:26.570 st W starsurge Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:27.488 st X wrath Fluffy_Pillow 6.0/100: 6% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 33907 32293 28583
Intellect 2089 0 13192 12395 9716 (5819)
Spirit 0 0 0 0 0
Health 678140 678140 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13192 12395 0
Crit 27.03% 20.82% 2847
Haste 23.03% 23.03% 3708
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 13720 12891 0
Mastery 27.57% 27.57% 6991
Armor 4288 4288 4288
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 464.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 447, stats: { 664 Armor, +2395 Sta, +605 Crit, +269 Mastery, +635 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 447, stats: { 581 Armor, +2395 Sta, +596 Haste, +278 Mastery, +635 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447 T30 4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=447,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=447,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=464.25
# gear_stamina=28583
# gear_intellect=9716
# gear_crit_rating=2847
# gear_haste_rating=3708
# gear_mastery_rating=6991
# gear_versatility_rating=747
# gear_armor=4288
# set_bonus=tier30_2pc=1
# set_bonus=tier30_4pc=1

447+460 2p_2p : 185442 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
185442.0 185442.0 92.6 / 0.050% 25898.9 / 14.0% 14860.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.6 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+460 2p_2p 185442
Astral Smolder 12023 6.5% 64.0 4.68s 56217 0 Periodic 116.5 30901 0 30901 0.0% 77.7%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.02 0.00 116.47 116.47 48.30 0.0000 2.0000 3599066.43 3599066.43 0.00% 15450.22 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.47 71 158 30900.89 7858 109491 30913.67 23400 41834 3599066 3599066 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5270) 0.0% (2.8%) 8.5 32.78s 185929 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 9128 2.8% 148.9 1.78s 10604 8166 Direct 148.0 8383 16749 10670 27.3%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.94 148.02 0.00 0.00 0.00 1.2986 0.0000 1579421.25 1579421.25 0.00% 8165.97 8165.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 107.55 19 308 8383.11 5189 14543 8376.24 7352 9989 901641 901641 0.00%
crit 27.34% 40.47 6 116 16748.62 11864 29086 16737.42 14393 20609 677780 677780 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.413
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:14709.31
Hungering Shadowflame 3026 1.6% 17.2 16.76s 52931 0 Direct 17.2 41514 83187 52930 27.4%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.15 17.15 0.00 0.00 0.00 0.0000 0.0000 907794.08 907794.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.60% 12.45 2 26 41513.97 27597 160192 41345.79 27838 92800 516925 516925 0.00%
crit 27.40% 4.70 0 15 83187.43 55195 320384 82403.92 0 320384 390869 390869 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2882 1.6% 33.9 8.72s 25475 0 Direct 33.8 20057 40089 25543 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.90 33.81 0.00 0.00 0.00 0.0000 0.0000 863555.84 863555.84 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.61% 24.55 9 48 20057.38 19533 22677 20056.45 19726 20863 492382 492382 0.00%
crit 27.39% 9.26 0 24 40089.07 39067 45353 40081.18 0 44419 371174 371174 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12242 6.6% 14.3 21.61s 255742 262814 Direct 14.3 9131 18553 12361 34.3%
Periodic 308.3 8232 17056 11315 34.9% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 308.28 308.28 13.33 0.9731 0.9677 3665199.91 3665199.91 0.00% 11737.02 262813.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.73% 9.42 1 17 9131.40 6281 16446 9125.41 7508 11419 86020 86020 0.00%
crit 34.27% 4.91 0 12 18553.14 12203 33520 18501.54 0 29156 91124 91124 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.07% 200.59 139 269 8232.07 382 15027 8233.99 7756 8810 1651247 1651247 0.00%
crit 34.93% 107.69 64 160 17056.30 757 30054 17063.67 15857 18707 1836810 1836810 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.27
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.06
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16617) 0.0% (9.0%) 17.0 18.00s 293502 245077

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.96 0.00 0.00 0.00 0.00 1.1976 0.0000 0.00 0.00 0.00% 245077.03 245077.03

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 5991 3.2% 5.3 63.23s 340659 183287 Direct 5.3 236535 467866 342581 45.8%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.28 5.25 0.00 0.00 0.00 1.8586 0.0000 1799693.62 1799693.62 0.00% 183286.85 183286.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.16% 2.85 0 6 236535.49 158479 388537 231934.93 0 370087 673066 673066 0.00%
crit 45.84% 2.41 0 6 467866.12 316959 777074 447059.44 0 740175 1126627 1126627 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.34
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4532 2.4% 6.0 53.61s 225699 299158 Direct 6.0 148405 312912 227141 47.9%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.96 0.00 0.00 0.00 0.7545 0.0000 1354588.31 1354588.31 0.00% 299158.19 299158.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.14% 3.11 0 7 148405.38 81281 232369 146327.61 0 224879 461483 461483 0.00%
crit 47.86% 2.85 0 7 312911.91 164470 464738 308985.02 0 464738 893105 893105 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6094 3.3% 5.7 58.00s 321317 262112 Direct 5.6 210339 419825 323266 53.9%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.64 0.00 0.00 0.00 1.2260 0.0000 1822987.56 1822987.56 0.00% 262111.80 262111.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.08% 2.60 0 7 210338.79 116841 339139 203420.13 0 339139 546602 546602 0.00%
crit 53.92% 3.04 0 7 419824.82 229680 678278 413856.50 0 659693 1276386 1276386 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (18001) 0.0% (9.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 7018 3.8% 94.2 3.16s 22313 0 Direct 94.0 15202 31621 22373 43.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.23 93.98 0.00 0.00 0.00 0.0000 0.0000 2102600.13 2102600.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.32% 52.93 24 93 15201.57 9826 29456 15202.48 13679 17615 804606 804606 0.00%
crit 43.68% 41.05 15 68 31620.93 19653 58911 31626.89 28214 36266 1297994 1297994 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 7036 3.8% 94.6 3.16s 22287 0 Direct 94.3 15180 31584 22347 43.7%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.58 94.33 0.00 0.00 0.00 0.0000 0.0000 2107891.59 2107891.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.31% 53.11 24 86 15179.80 9826 29456 15180.11 13675 17317 806263 806263 0.00%
crit 43.69% 41.21 18 79 31584.01 19653 58911 31591.98 28369 36896 1301628 1301628 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 3947 2.1% 6.3 48.19s 188116 0 Direct 6.3 128121 266405 188650 43.8%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.29 6.27 0.00 0.00 0.00 0.0000 0.0000 1182575.11 1182575.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.23% 3.53 0 8 128120.95 82685 247858 127015.29 0 228643 451685 451685 0.00%
crit 43.77% 2.74 0 8 266404.71 167345 495715 258837.50 0 450650 730890 730890 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 4954 2.7% 26.0 11.47s 57106 63467 Direct 27.0 39168 78277 54995 40.5%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.04 27.04 0.00 0.00 0.00 0.8998 0.0000 1487223.80 1487223.80 0.00% 63467.07 63467.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.53% 16.10 4 29 39167.92 17245 72466 39180.09 29273 46063 630597 630597 0.00%
crit 40.47% 10.94 2 23 78277.34 34489 147977 78295.58 52362 92771 856627 856627 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.11
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 57272 (77360) 30.9% (41.7%) 115.0 2.59s 201335 202719 Direct 114.7 (152.5) 103405 213785 149358 41.6% (42.1%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 114.97 114.73 0.00 0.00 0.00 0.9932 0.0000 17136243.77 17136243.77 0.00% 202718.87 202718.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.37% 66.97 38 96 103405.39 65238 195125 103420.48 95594 114270 6925082 6925082 0.00%
crit 41.63% 47.76 24 76 213784.69 149715 390250 213889.51 193311 242210 10211162 10211162 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.26
  • if_expr:variable.starsurge_condition1
    st
    [X]:30.71
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20088 10.8% 37.9 7.76s 158469 0 Direct 37.8 108821 224340 159250 43.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.94 37.75 0.00 0.00 0.00 0.0000 0.0000 6012021.20 6012021.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.35% 21.27 6 46 108821.36 78275 204034 108842.72 94678 128797 2314888 2314888 0.00%
crit 43.65% 16.48 4 36 224339.75 156550 408067 224452.24 188248 278160 3697133 3697133 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 12054 6.5% 17.4 18.04s 207716 212836 Direct 17.4 8953 18091 12443 38.2%
Periodic 309.2 7942 16091 10977 37.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 309.24 309.24 16.38 0.9760 0.9678 3610974.33 3610974.33 0.00% 11418.53 212835.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.80% 10.74 2 20 8952.57 5644 15702 8943.02 7575 10581 96187 96187 0.00%
crit 38.20% 6.64 0 16 18090.92 11287 31405 18081.92 0 25864 120128 120128 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.75% 194.05 131 273 7941.64 128 13661 7940.15 7519 8408 1541062 1541062 0.00%
crit 37.25% 115.19 69 164 16091.07 5593 27322 16090.69 15083 17406 1853597 1853597 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.54
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.85
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3212) 0.0% (1.7%) 8.5 32.42s 113405 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1673 0.9% 8.5 32.42s 59050 0 Direct 8.5 46339 92611 59048 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 8.49 0.00 0.00 0.00 0.0000 0.0000 501226.61 501226.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 6.16 0 17 46338.56 45085 52340 46313.64 0 52340 285277 285277 0.00%
crit 27.47% 2.33 0 11 92610.52 90170 104681 84464.36 0 104681 215950 215950 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1540 0.8% 16.4 15.69s 28055 0 Direct 16.4 22036 44042 28054 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.45 16.45 0.00 0.00 0.00 0.0000 0.0000 461383.58 461383.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.65% 11.95 1 33 22036.31 21453 24905 22035.69 21507 24649 263294 263294 0.00%
crit 27.35% 4.50 0 14 44042.33 42906 49811 43448.18 0 49811 198089 198089 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 17801 9.6% 115.3 2.54s 46242 48635 Direct 114.9 31172 64138 46406 46.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.27 114.87 0.00 0.00 0.00 0.9508 0.0000 5330459.22 5330459.22 0.00% 48634.69 48634.69
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.79% 61.78 36 91 31171.76 12813 104421 31168.72 27595 35780 1925948 1925948 0.00%
crit 46.21% 53.08 29 83 64138.23 25625 198474 64142.75 55188 73740 3404511 3404511 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.57

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+460 2p_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 183.31s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 82.38s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+460 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.14s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.26s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.4s 33.8s 8.6s 24.91% 28.78% 1.5 (7.0) 8.5

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.5s
  • trigger_min/max:2.8s / 51.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.19% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.86%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.39%
  • balance_of_all_things_arcane_8:3.40%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.40% 54.48% 3.5 (20.1) 17.4

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.0s
  • uptime_min/max:45.94% / 54.00%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.94%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.32%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.91%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.7s 70.7s 10.8s 9.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 346.2s
  • trigger_min/max:12.0s / 346.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.92%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.1s 70.7s 45.7s 33.36% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 346.2s
  • trigger_min/max:12.0s / 346.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.36%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.2s 70.2s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.2s
  • trigger_min/max:12.0s / 338.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.54%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.7s 70.2s 45.7s 33.25% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 357.0s
  • trigger_min/max:12.0s / 338.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 327.2s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.25%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.5s 70.5s 10.8s 10.01% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 332.9s
  • trigger_min/max:12.0s / 332.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.24%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.7s 70.5s 45.9s 33.39% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 358.1s
  • trigger_min/max:12.0s / 332.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.39%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.4s 50.2s 80.20% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 344.0s
  • trigger_min/max:15.0s / 319.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.2s
  • uptime_min/max:44.52% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.20%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.2s 32.1s 41.2s 57.10% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 252.4s
  • trigger_min/max:0.0s / 145.5s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 271.8s
  • uptime_min/max:18.44% / 96.75%

Stack Uptimes

  • denizen_of_the_dream_1:38.51%
  • denizen_of_the_dream_2:14.34%
  • denizen_of_the_dream_3:3.50%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.4 20.0s 20.7s 3.1s 16.02% 21.30% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.6s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.3s
  • uptime_min/max:9.05% / 28.69%

Stack Uptimes

  • dreamstate_1:9.62%
  • dreamstate_2:6.40%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.3s 44.9s 20.6s 49.28% 52.51% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.2s
  • trigger_min/max:12.0s / 90.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.14%

Stack Uptimes

  • eclipse_lunar_1:49.28%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.2s 92.65% 95.98% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.4s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.45% / 95.00%

Stack Uptimes

  • eclipse_solar_1:92.65%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.1s 307.1s 27.4s 13.20% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.0s
  • trigger_min/max:300.0s / 328.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.20%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.6s 32.1s 24.9s 43.30% 43.25% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 189.7s
  • trigger_min/max:0.0s / 145.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 139.2s
  • uptime_min/max:14.24% / 83.87%

Stack Uptimes

  • friend_of_the_fae_1:43.30%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.9s 44.9s 20.3s 48.36% 51.25% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.2s
  • trigger_min/max:12.0s / 90.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.33% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.36%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.8s 99.8s 19.5s 23.24% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 128.1s
  • trigger_min/max:90.0s / 128.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.25% / 26.35%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.15%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.18%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.35% 0.00% 0.0 (0.0) 12.5

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.1s
  • trigger_min/max:12.8s / 70.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.47% / 30.05%

Stack Uptimes

  • natures_grace_1:25.35%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.1s
  • trigger_min/max:90.0s / 92.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.55% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.9s 68.9s 7.7s 6.22% 6.92% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 351.4s
  • trigger_min/max:0.0s / 351.4s
  • trigger_pct:14.93%
  • duration_min/max:0.0s / 27.8s
  • uptime_min/max:0.00% / 27.83%

Stack Uptimes

  • owlkin_frenzy_1:6.22%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 107.8 38.9s 38.9s 34.8s 93.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.4s / 51.1s
  • trigger_min/max:24.4s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 48.3s
  • uptime_min/max:89.86% / 96.74%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.01%
  • primordial_arcanic_pulsar_8:5.53%
  • primordial_arcanic_pulsar_12:6.57%
  • primordial_arcanic_pulsar_16:6.95%
  • primordial_arcanic_pulsar_20:6.44%
  • primordial_arcanic_pulsar_24:6.06%
  • primordial_arcanic_pulsar_28:7.87%
  • primordial_arcanic_pulsar_32:8.02%
  • primordial_arcanic_pulsar_36:6.59%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:6.95%
  • primordial_arcanic_pulsar_48:7.04%
  • primordial_arcanic_pulsar_52:7.26%
  • primordial_arcanic_pulsar_56:6.48%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.55% 39.79% 4.0 (4.0) 18.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.7s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.29% / 42.54%

Stack Uptimes

  • solstice_1:39.55%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.7 94.2 14.7s 2.6s 14.1s 97.25% 0.00% 53.2 (53.2) 7.6

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.8s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.86% / 99.12%

Stack Uptimes

  • starlord_1:9.48%
  • starlord_2:15.45%
  • starlord_3:72.31%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.2 48.3 48.0s 5.5s 43.3s 90.20% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 330.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.6s
  • uptime_min/max:72.22% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.20%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.9s 45.3s 16.5s 23.72% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 217.6s
  • trigger_min/max:0.0s / 211.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.5s
  • uptime_min/max:4.52% / 58.60%

Stack Uptimes

  • wafting_devotion_1:23.72%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.4s 48.4s 22.0s 44.80% 43.86% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 81.9s
  • trigger_min/max:45.0s / 81.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.52% / 51.22%

Stack Uptimes

  • warrior_of_elune_1:21.74%
  • warrior_of_elune_2:4.90%
  • warrior_of_elune_3:18.16%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 22.0 32.1s 0.0s 145.5s
Primordial Arcanic Pulsar 7.1 6.0 9.0 40.6s 29.4s 51.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.94% 0.5s 0.0s 3.4s
Astral Smolder 77.92% 54.59% 93.56% 14.9s 0.0s 114.0s
Incarnation (Total) 48.36% 43.33% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.08% 25.86% 30.61% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.30% 36.05% 50.33% 10.8s 0.0s 15.0s
No Eclipse 6.40% 3.88% 8.61% 1.5s 0.0s 3.8s
Friend of the Fae 43.30% 14.24% 83.87% 24.9s 0.0s 139.2s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0860.00036.87443.54926.48370.644
Full Moon
New Moon
Half Moon
0.3490.00024.9225.9155.33630.622

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.154.5%56.2349.6%0.000.0%51.8945.8%
Starfire25.0492.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.2540.2%0.000.0%68.7259.8%
New Moon0.040.7%0.183.0%0.000.0%5.7896.3%
Half Moon0.000.1%0.335.7%0.000.0%5.3594.2%
Full Moon0.232.0%3.1327.1%0.070.6%8.1470.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+460 2p_2p
Nature's BalanceAstral Power99.43198.765.48%2.000.110.05%
Full MoonAstral Power5.28263.857.28%49.950.280.11%
Half MoonAstral Power5.67136.183.76%24.000.000.00%
MoonfireAstral Power14.3385.922.37%6.000.060.08%
New MoonAstral Power6.0072.021.99%12.000.000.00%
Orbit BreakerAstral Power6.29187.535.17%29.831.050.56%
Shooting Stars (Moonfire)Astral Power94.23188.255.19%2.000.200.10%
Shooting Stars (Sunfire)Astral Power94.58188.965.21%2.000.190.10%
StarfireAstral Power27.04397.1210.96%14.682.720.68%
SunfireAstral Power17.38104.292.88%6.000.020.01%
WrathAstral Power115.281801.4849.70%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+460 2p_2p
StarsurgeAstral Power 115.163636.15100.00%31.5731.636366.14
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 695320.0 3187.01 3763.43 1382068.3 522514.7 -308451.7 695320.0
Astral Power 70.0 12.09 12.11 4.6 24.2 0.0 100.0

Statistics & Data Analysis

Fight Length
447+460 2p_2p Fight Length
Count 19475
Mean 299.79
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.7709
5th Percentile 245.75
95th Percentile 354.03
( 95th Percentile - 5th Percentile ) 108.27
Mean Distribution
Standard Deviation 0.2492
95.00% Confidence Interval ( 299.30 - 300.28 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 517
0.1% Error 51677
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1033
DPS
447+460 2p_2p Damage Per Second
Count 19475
Mean 185441.96
Minimum 162861.95
Maximum 216701.75
Spread ( max - min ) 53839.81
Range [ ( max - min ) / 2 * 100% ] 14.52%
Standard Deviation 6593.9918
5th Percentile 174980.86
95th Percentile 196806.34
( 95th Percentile - 5th Percentile ) 21825.48
Mean Distribution
Standard Deviation 47.2509
95.00% Confidence Interval ( 185349.35 - 185534.57 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4858
0.1 Scale Factor Error with Delta=300 371177
0.05 Scale Factor Error with Delta=300 1484707
0.01 Scale Factor Error with Delta=300 37117651
Priority Target DPS
447+460 2p_2p Priority Target Damage Per Second
Count 19475
Mean 185441.96
Minimum 162861.95
Maximum 216701.75
Spread ( max - min ) 53839.81
Range [ ( max - min ) / 2 * 100% ] 14.52%
Standard Deviation 6593.9918
5th Percentile 174980.86
95th Percentile 196806.34
( 95th Percentile - 5th Percentile ) 21825.48
Mean Distribution
Standard Deviation 47.2509
95.00% Confidence Interval ( 185349.35 - 185534.57 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4858
0.1 Scale Factor Error with Delta=300 371177
0.05 Scale Factor Error with Delta=300 1484707
0.01 Scale Factor Error with Delta=300 37117651
DPS(e)
447+460 2p_2p Damage Per Second (Effective)
Count 19475
Mean 185441.96
Minimum 162861.95
Maximum 216701.75
Spread ( max - min ) 53839.81
Range [ ( max - min ) / 2 * 100% ] 14.52%
Damage
447+460 2p_2p Damage
Count 19475
Mean 53945485.08
Minimum 40894999.83
Maximum 69033600.51
Spread ( max - min ) 28138600.69
Range [ ( max - min ) / 2 * 100% ] 26.08%
DTPS
447+460 2p_2p Damage Taken Per Second
Count 19475
Mean 3763.52
Minimum 1092.34
Maximum 7288.11
Spread ( max - min ) 6195.77
Range [ ( max - min ) / 2 * 100% ] 82.31%
HPS
447+460 2p_2p Healing Per Second
Count 19475
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+460 2p_2p Healing Per Second (Effective)
Count 19475
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+460 2p_2p Heal
Count 19475
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+460 2p_2p Healing Taken Per Second
Count 19475
Mean 3177.97
Minimum 697.55
Maximum 6561.54
Spread ( max - min ) 5863.99
Range [ ( max - min ) / 2 * 100% ] 92.26%
TMI
447+460 2p_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+460 2p_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+460 2p_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.54 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.27 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.11 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.26 starsurge,if=variable.starsurge_condition1
R 15.85 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.06 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.34 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.22 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 30.71 starsurge,if=variable.starsurge_condition2
Y 113.57 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQQTUQVXYYXRYXYWQQSQYYYYYXYXYOTXYYWQQQRYQYYQYXYSYXYXYWQPPQYQRYQYYYYWQQPPQSYYQRUYYOWQQQVXYPPQQSYYRYQQYFYQYYPPQQYYYWQQRYQSYYXETQUYYWQQOYQYYRPPQQYYSYWQQYQYYYXPPQRYWQYYQYQSYXVXTYWQQQJYOYXPPQYQYYSYQQRYQYYFPPQNQUYWQYQQVQQRQSYYYYEWQQQYYTYYXYRXYYWQQQSOYYYYXXYYPPXYRQQQUQYQSYYXXPPYQQRYYQYYYYXYPPQQKQRYYYOYFXYYXVQQQTSYRXYXPPYXWQYQQYYYYXYRPDPWQQESQYYQYYYOYXUWQQQRVXSX

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+460 2p_2p 50.0/100: 50% astral_power
Pre precombat 1 food 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+460 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+460 2p_2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.941 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.882 st L starfire Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.728 st N incarnation_chosen_of_elune Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.728 default D potion Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.728 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.728 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.583 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.406 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.198 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.960 st T new_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.713 st U half_moon Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.731 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.494 st V full_moon Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.017 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.780 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.536 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.290 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.052 st R sunfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.815 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.580 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.342 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.106 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.106 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.962 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.785 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.578 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.371 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.132 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.897 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.661 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.424 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.188 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.954 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.717 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(48), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.480 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.245 st O warrior_of_elune Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:26.245 st T new_moon Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.220 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:27.984 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:28.748 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.511 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:29.511 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:30.364 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord, warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.189 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:31.983 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, elemental_potion_of_ultimate_power
0:32.747 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak
0:33.511 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak
0:34.274 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
0:35.039 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
0:35.801 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
0:36.563 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
0:37.327 st X starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
0:38.090 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
0:38.854 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
0:39.618 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
0:40.381 st X starsurge Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
0:41.372 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:42.362 st X starsurge Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:43.354 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.346 st W cancel_buff Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.346 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:45.456 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
0:46.210 st P starfire Fluffy_Pillow 46.8/100: 47% astral_power natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
0:46.964 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:48.031 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:49.061 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:50.088 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:51.079 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:52.170 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:53.261 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:54.352 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:55.445 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:56.535 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:57.625 st W cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:57.625 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(44), best_friends_with_urctos_static, undulating_sporecloak
0:58.846 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord, best_friends_with_urctos_static, undulating_sporecloak
1:00.021 st P starfire Fluffy_Pillow 13.6/100: 14% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:01.718 st P starfire Fluffy_Pillow 25.6/100: 26% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:02.642 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:03.670 st S moonfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:04.661 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:05.415 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:06.407 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:07.400 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:08.393 st U half_moon Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:09.716 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:10.708 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.700 st O warrior_of_elune Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.700 st W cancel_buff Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.700 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:12.811 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord, warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:13.879 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(2), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:14.907 st V full_moon Fluffy_Pillow 9.6/100: 10% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:16.887 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:17.879 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:18.869 st P starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:19.623 st P starfire Fluffy_Pillow 68.4/100: 68% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:20.378 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:21.369 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:22.360 st S moonfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:23.351 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:24.341 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:25.332 st R sunfire Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
1:26.422 st Y wrath Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:27.429 st Q starsurge Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:28.558 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:29.642 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
1:30.688 default F natures_vigil 447+460 2p_2p 33.2/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:30.688 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:31.732 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:32.779 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:33.788 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion
1:34.797 st P starfire Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion
1:35.551 st P starfire Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:36.377 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:37.292 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:38.207 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:39.123 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:40.038 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:40.953 st W cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:40.953 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(44), solstice, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:42.081 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:43.167 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:44.213 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:45.259 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:46.306 st S moonfire Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:47.314 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:48.324 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:49.332 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:50.339 default E use_items Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:50.339 st T new_moon Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:51.093 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:52.008 st U half_moon Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
1:53.229 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
1:54.145 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
1:55.058 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
1:55.058 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
1:56.085 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
1:57.074 st O warrior_of_elune Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
1:57.074 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
1:58.024 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
1:58.976 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
1:59.893 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
2:00.809 st R sunfire Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
2:01.727 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
2:02.480 st P starfire Fluffy_Pillow 70.8/100: 71% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
2:03.235 st Q starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
2:04.229 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:05.220 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
2:06.212 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
2:07.202 st S moonfire Fluffy_Pillow 61.6/100: 62% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
2:08.194 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
2:09.285 st W cancel_buff Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:09.285 st Q starsurge Fluffy_Pillow 91.6/100: 92% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(24), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:10.507 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord, warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:11.683 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:12.816 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:13.947 st Y wrath Fluffy_Pillow 3.6/100: 4% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:15.037 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:16.126 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:17.218 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak
2:18.309 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
2:19.064 st P starfire Fluffy_Pillow 38.4/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
2:19.957 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
2:20.948 st R sunfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
2:21.941 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
2:22.934 st W cancel_buff Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
2:22.934 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
2:24.043 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:25.217 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:26.391 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:27.564 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak
2:28.695 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak
2:29.826 st S moonfire Fluffy_Pillow 28.4/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:30.917 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:32.007 st X starsurge Fluffy_Pillow 56.4/100: 56% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:33.098 st V full_moon Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:34.927 st X starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:35.844 st T new_moon Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:36.598 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.513 st W cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.513 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:38.540 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:39.529 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:40.479 st J sunfire Fluffy_Pillow 8.4/100: 8% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:41.395 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:42.311 st O warrior_of_elune Fluffy_Pillow 32.4/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:42.311 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:43.229 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:44.145 st P starfire Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:44.899 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:45.654 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:46.571 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:47.487 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:48.404 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:49.397 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:50.387 st S moonfire Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:51.477 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:52.565 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:53.787 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:54.962 st R sunfire Fluffy_Pillow 12.0/100: 12% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
2:56.094 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:57.224 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:58.357 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:59.446 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.538 default F natures_vigil 447+460 2p_2p 32.0/100: 32% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.688 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:01.441 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:02.333 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:03.325 st N incarnation_chosen_of_elune Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:03.325 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:04.229 st U half_moon Fluffy_Pillow 0.8/100: 1% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:05.431 st Y wrath Fluffy_Pillow 24.8/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:06.184 st W cancel_buff Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:06.184 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:07.296 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:08.050 st Q starsurge Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:09.118 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:10.147 st V full_moon Fluffy_Pillow 20.8/100: 21% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:12.127 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:13.117 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:14.108 st R sunfire Fluffy_Pillow 26.8/100: 27% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:15.099 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:16.092 st S moonfire Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:17.082 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.074 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:19.066 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:20.057 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:21.050 default E use_items Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:21.050 st W cancel_buff Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:21.050 st Q starsurge Fluffy_Pillow 86.8/100: 87% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage, kindled_soul(100)
3:22.162 st Q starsurge Fluffy_Pillow 58.8/100: 59% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage, kindled_soul(95)
3:23.228 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, kindled_soul(90)
3:24.254 st Y wrath Fluffy_Pillow 6.8/100: 7% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, kindled_soul(85)
3:25.247 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, kindled_soul(80)
3:26.238 st T new_moon Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, kindled_soul(75)
3:27.221 st Y wrath Fluffy_Pillow 52.8/100: 53% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(70)
3:28.137 st Y wrath Fluffy_Pillow 68.8/100: 69% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(65)
3:29.053 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(60)
3:29.969 st Y wrath Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, wafting_devotion, kindled_soul(60)
3:30.885 st R sunfire Fluffy_Pillow 74.8/100: 75% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(55)
3:31.801 st X starsurge Fluffy_Pillow 80.8/100: 81% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(50)
3:32.718 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(45)
3:33.633 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(40)
3:34.548 st W cancel_buff Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(35)
3:34.548 st Q starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(35)
3:35.575 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(30)
3:36.561 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(25)
3:37.511 st S moonfire Fluffy_Pillow 8.8/100: 9% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(20)
3:38.428 st O warrior_of_elune Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:38.428 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:39.345 st Y wrath Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
3:40.262 st Y wrath Fluffy_Pillow 50.8/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
3:41.180 st Y wrath Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:42.098 st X starsurge Fluffy_Pillow 84.8/100: 85% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:43.014 st X starsurge Fluffy_Pillow 56.8/100: 57% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.007 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.997 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:45.988 st P starfire Fluffy_Pillow 60.8/100: 61% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.743 st P starfire Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:47.499 st X starsurge Fluffy_Pillow 98.4/100: 98% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.489 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:49.479 st R sunfire Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:50.471 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:51.582 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:52.648 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.675 st U half_moon Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:54.998 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.990 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:56.981 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:57.974 st S moonfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:58.965 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:59.959 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:00.950 st X starsurge Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:01.940 st X starsurge Fluffy_Pillow 48.4/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:02.932 st P starfire Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, corrupting_rage
4:03.687 st P starfire Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, corrupting_rage
4:04.580 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
4:05.571 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:06.680 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:07.749 st R sunfire Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:08.776 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:09.909 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:11.041 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:12.174 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature, denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:13.263 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:14.354 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:15.444 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:16.534 st X starsurge Fluffy_Pillow 83.2/100: 83% astral_power denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:17.625 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:18.715 st P starfire Fluffy_Pillow 69.2/100: 69% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:20.351 st P starfire Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
4:21.243 st Q starsurge Fluffy_Pillow 97.2/100: 97% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
4:22.353 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
4:23.419 st K moonfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
4:24.448 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:25.476 st R sunfire Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
4:26.467 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
4:27.220 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
4:28.310 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
4:29.400 st O warrior_of_elune Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:29.400 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
4:30.490 default F natures_vigil 447+460 2p_2p 83.2/100: 83% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:30.688 st X starsurge Fluffy_Pillow 83.2/100: 83% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:31.778 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:32.869 st Y wrath Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:33.959 st X starsurge Fluffy_Pillow 81.2/100: 81% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:35.049 st V full_moon Fluffy_Pillow 45.2/100: 45% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:37.028 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:38.139 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:39.206 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, corrupting_rage
4:40.234 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:40.990 st S moonfire Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:41.981 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:42.974 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:43.965 st X starsurge Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:44.957 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak
4:45.947 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static
4:46.938 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static
4:47.691 st P starfire Fluffy_Pillow 46.8/100: 47% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static
4:48.445 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
4:49.435 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
4:50.427 st W cancel_buff Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static
4:50.427 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_urctos_static
4:51.538 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static
4:52.606 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static
4:53.780 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, best_friends_with_urctos_static
4:54.913 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static
4:56.004 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:57.096 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:58.105 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:59.112 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:00.121 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:01.129 st R sunfire Fluffy_Pillow 59.6/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:02.136 st P starfire Fluffy_Pillow 67.6/100: 68% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:03.646 default D potion Fluffy_Pillow 85.6/100: 86% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
5:03.646 st P starfire Fluffy_Pillow 85.6/100: 86% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:04.471 st W cancel_buff Fluffy_Pillow 97.6/100: 98% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:04.471 st Q starsurge Fluffy_Pillow 97.6/100: 98% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:05.497 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:06.483 default E use_items Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
5:06.483 st S moonfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:07.434 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), dreamstate, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
5:08.383 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
5:09.136 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
5:10.145 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
5:11.154 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
5:12.163 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:13.253 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:14.343 st O warrior_of_elune Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:14.400 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:15.491 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:16.582 st U half_moon Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:17.903 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:17.903 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:19.013 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:20.082 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:21.111 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:22.102 st V full_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
5:24.081 st X starsurge Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:25.074 st S moonfire Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:26.065 st X starsurge Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 34766 33111 29401
Intellect 2089 0 13371 12565 9878 (5981)
Spirit 0 0 0 0 0
Health 695320 695320 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13371 12565 0
Crit 27.22% 21.01% 2881
Haste 23.23% 23.23% 3742
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 13906 13068 0
Mastery 27.66% 27.66% 7021
Armor 4406 4406 4406
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 466.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+460 2p_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=465.88
# gear_stamina=29401
# gear_intellect=9878
# gear_crit_rating=2881
# gear_haste_rating=3742
# gear_mastery_rating=7021
# gear_versatility_rating=747
# gear_armor=4406
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

447+470 2p_2p : 187914 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
187913.8 187913.8 93.8 / 0.050% 26072.1 / 13.9% 15045.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.6 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
447+470 2p_2p 187914
Astral Smolder 12208 6.5% 64.3 4.60s 56872 0 Periodic 116.7 31342 0 31342 0.0% 77.8%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.29 0.00 116.66 116.66 48.60 0.0000 2.0000 3656468.47 3656468.47 0.00% 15671.00 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.66 75 159 31341.95 7953 110704 31351.33 22623 40921 3656468 3656468 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5358) 0.0% (2.9%) 8.5 31.80s 188507 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.52 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 9258 2.9% 149.6 1.72s 10739 8281 Direct 148.7 8481 16938 10806 27.5%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.62 148.69 0.00 0.00 0.00 1.2968 0.0000 1606765.01 1606765.01 0.00% 8281.35 8281.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.51% 107.82 18 289 8480.94 6099 14669 8475.63 7447 10246 914428 914428 0.00%
crit 27.49% 40.87 5 103 16938.25 12561 29337 16931.41 14506 20768 692337 692337 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.195
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:14380.62
Hungering Shadowflame 3045 1.6% 17.2 17.02s 53033 0 Direct 17.2 41441 83404 53032 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.24 17.24 0.00 0.00 0.00 0.0000 0.0000 914109.67 914109.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.38% 12.48 3 28 41440.74 27597 160192 41264.06 27758 113548 516968 516968 0.00%
crit 27.62% 4.76 0 15 83404.45 55195 320384 82677.01 0 320384 397142 397142 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2891 1.5% 34.0 8.60s 25512 0 Direct 33.9 20055 40085 25581 27.6%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.97 33.88 0.00 0.00 0.00 0.0000 0.0000 866582.04 866582.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.41% 24.53 7 51 20055.50 19533 22677 20055.14 19743 20866 491946 491946 0.00%
crit 27.59% 9.35 1 24 40084.62 39067 45353 40086.05 39067 45353 374636 374636 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 12405 6.6% 14.3 21.61s 259132 266487 Direct 14.3 9238 18785 12520 34.4%
Periodic 308.7 8329 17248 11456 35.1% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 308.73 308.73 13.34 0.9725 0.9670 3716422.13 3716422.13 0.00% 11893.69 266486.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.62% 9.41 2 16 9238.08 6249 16984 9232.11 7855 11675 86945 86945 0.00%
crit 34.38% 4.93 0 13 18784.90 13984 33183 18731.38 0 29081 92616 92616 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 64.94% 200.47 131 264 8328.93 33 15153 8331.01 7865 8927 1669723 1669723 0.00%
crit 35.06% 108.25 63 156 17247.77 1813 30307 17254.85 16153 18890 1867138 1867138 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.39

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.39
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16824) 0.0% (9.0%) 17.0 17.97s 297133 248267

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.97 0.00 0.00 0.00 0.00 1.1969 0.0000 0.00 0.00 0.00% 248267.33 248267.33

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6072 3.2% 5.3 63.02s 345096 185790 Direct 5.3 239605 472987 347410 46.2%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.25 0.00 0.00 0.00 1.8575 0.0000 1825390.37 1825390.37 0.00% 185790.37 185790.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.82% 2.83 0 6 239604.53 160576 392162 235202.63 0 376679 677603 677603 0.00%
crit 46.18% 2.43 0 6 472986.82 321151 796599 451873.61 0 796599 1147788 1147788 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4565 2.4% 6.0 53.65s 227436 301462 Direct 6.0 149954 316282 228853 47.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.97 0.00 0.00 0.00 0.7545 0.0000 1365624.69 1365624.69 0.00% 301462.40 301462.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.57% 3.14 0 7 149953.80 82356 234468 148097.70 0 226554 470435 470435 0.00%
crit 47.43% 2.83 0 7 316281.54 176703 468936 312122.78 0 462481 895190 895190 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6186 3.3% 5.7 57.80s 326164 266332 Direct 5.6 212944 425300 328050 54.2%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.64 0.00 0.00 0.00 1.2247 0.0000 1851542.76 1851542.76 0.00% 266332.39 266332.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.80% 2.58 0 7 212944.46 118386 337452 205798.17 0 322303 550393 550393 0.00%
crit 54.20% 3.06 0 7 425299.92 236773 684324 419225.21 0 653603 1301150 1301150 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (18262) 0.0% (9.7%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 7119 3.8% 94.4 3.16s 22613 0 Direct 94.1 15393 32002 22676 43.8%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.40 94.13 0.00 0.00 0.00 0.0000 0.0000 2134598.75 2134598.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.15% 52.86 26 91 15392.63 9956 29715 15392.77 13944 17314 813624 813624 0.00%
crit 43.85% 41.28 15 70 32002.15 19913 59430 32008.42 28571 37208 1320975 1320975 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 7129 3.8% 94.6 3.17s 22587 0 Direct 94.3 15371 31969 22650 43.9%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.61 94.34 0.00 0.00 0.00 0.0000 0.0000 2136928.91 2136928.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.14% 52.97 23 86 15370.66 9956 29715 15369.28 13931 17486 814161 814161 0.00%
crit 43.86% 41.38 18 68 31968.88 19913 59430 31974.39 28398 36835 1322768 1322768 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4014 2.1% 6.3 48.26s 191121 0 Direct 6.3 129559 269771 191730 44.3%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.30 6.28 0.00 0.00 0.00 0.0000 0.0000 1203511.22 1203511.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.66% 3.49 0 8 129559.49 84779 250039 128402.65 0 236273 452694 452694 0.00%
crit 44.34% 2.78 0 8 269771.31 167557 486380 262310.55 0 461601 750817 750817 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5016 2.7% 26.1 11.46s 57808 64281 Direct 27.1 39664 79195 55672 40.5%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.07 27.07 0.00 0.00 0.00 0.8993 0.0000 1506800.97 1506800.97 0.00% 64280.58 64280.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.50% 16.11 5 29 39663.57 17458 71070 39673.54 31487 47098 638781 638781 0.00%
crit 40.50% 10.96 1 24 79194.83 34916 144824 79214.16 51220 96078 868020 868020 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.13
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 58075 (78434) 30.9% (41.7%) 115.1 2.59s 203996 205597 Direct 114.9 (152.7) 104675 216428 151357 41.8% (42.3%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.13 114.88 0.00 0.00 0.00 0.9922 0.0000 17388259.78 17388259.78 0.00% 205596.73 205596.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.23% 66.90 39 96 104675.46 66870 196842 104692.20 96860 114674 7002374 7002374 0.00%
crit 41.77% 47.99 23 74 216427.85 149647 393685 216538.01 195380 240488 10385886 10385886 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.12
  • if_expr:variable.starsurge_condition1
    st
    [X]:31.01
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20359 10.8% 38.0 7.75s 160644 0 Direct 37.8 110138 227181 161406 43.8%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.95 37.77 0.00 0.00 0.00 0.0000 0.0000 6096848.73 6096848.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.20% 21.23 6 42 110138.30 79310 205829 110165.43 93446 131704 2337850 2337850 0.00%
crit 43.80% 16.55 3 32 227180.89 158621 411658 227234.72 191492 273851 3758999 3758999 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 12218 6.5% 17.4 18.05s 210545 215885 Direct 17.4 9058 18308 12595 38.2%
Periodic 309.7 8035 16277 11119 37.4% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 309.69 309.69 16.39 0.9753 0.9670 3662496.08 3662496.08 0.00% 11574.50 215885.42
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.76% 10.74 2 20 9057.83 5712 15834 9047.64 7039 10681 97306 97306 0.00%
crit 38.24% 6.65 0 16 18307.57 11423 31342 18298.07 0 26673 121796 121796 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.59% 193.83 129 265 8035.29 344 13776 8033.90 7606 8537 1557485 1557485 0.00%
crit 37.41% 115.86 65 165 16277.45 877 27551 16276.83 15315 17433 1885909 1885909 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.26

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.26
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.52
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.88
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountDruid Balance 10.1 Class Set 2pc4055102PCT0.200
Spell Periodic AmountDruid Balance 10.1 Class Set 2pc4055103PCT0.200

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3206) 0.0% (1.7%) 8.5 32.66s 113509 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1669 0.9% 8.5 32.66s 59093 0 Direct 8.5 46336 92592 59090 27.6%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.00 0.0000 0.0000 500510.88 500510.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.42% 6.13 0 16 46335.60 45085 52340 46308.38 0 52340 284222 284222 0.00%
crit 27.58% 2.34 0 13 92592.32 90170 104681 84496.47 0 104681 216289 216289 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1537 0.8% 16.4 15.79s 28081 0 Direct 16.4 22035 44041 28082 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.41 16.41 0.00 0.00 0.00 0.0000 0.0000 460902.52 460902.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.52% 11.90 0 31 22035.08 21453 24905 22032.57 0 24033 262297 262297 0.00%
crit 27.48% 4.51 0 16 44040.80 42906 49811 43436.49 0 49811 198606 198606 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 18046 9.6% 115.5 2.54s 46811 49265 Direct 115.1 31517 64876 46976 46.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.51 115.10 0.00 0.00 0.00 0.9502 0.0000 5407014.70 5407014.70 0.00% 49265.30 49265.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.66% 61.77 34 91 31517.27 12967 99473 31514.27 27848 35477 1946730 1946730 0.00%
crit 46.34% 53.34 29 80 64876.40 25935 208427 64884.77 55782 77690 3460285 3460285 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.81

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
447+470 2p_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 183.83s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 69.07s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.33s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:447+470 2p_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.25s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.48
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.34s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.4s 33.8s 8.6s 24.89% 28.75% 1.5 (7.1) 8.5

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.4s
  • trigger_min/max:2.9s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.14% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.03%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.39%
  • balance_of_all_things_arcane_8:3.40%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.40% 54.46% 3.5 (20.2) 17.4

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.9s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.3s
  • uptime_min/max:45.88% / 54.11%

Stack Uptimes

  • balance_of_all_things_nature_1:5.83%
  • balance_of_all_things_nature_2:5.93%
  • balance_of_all_things_nature_3:6.05%
  • balance_of_all_things_nature_4:6.17%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.67%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.6s 70.6s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.9s
  • trigger_min/max:12.0s / 338.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.18%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 114.7s 70.6s 46.0s 33.55% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 355.3s
  • trigger_min/max:12.0s / 338.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 302.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.55%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 342.3s
  • trigger_min/max:12.0s / 342.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.86%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.1s 70.4s 45.8s 33.32% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 351.5s
  • trigger_min/max:12.0s / 342.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 354.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.32%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.3s 70.3s 10.8s 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 341.3s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.11%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.89%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.90%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.91%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.92%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.2s 70.3s 45.6s 33.13% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 358.8s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 297.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.13%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.8 0.0 62.1s 58.4s 50.4s 80.28% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 355.0s
  • trigger_min/max:15.0s / 324.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.7s
  • uptime_min/max:45.70% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.28%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.0s 32.1s 41.1s 57.23% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 276.4s
  • trigger_min/max:0.0s / 154.8s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 277.0s
  • uptime_min/max:20.16% / 97.95%

Stack Uptimes

  • denizen_of_the_dream_1:38.57%
  • denizen_of_the_dream_2:14.38%
  • denizen_of_the_dream_3:3.54%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.00%
  • denizen_of_the_dream_8:0.00%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.4 20.1s 20.7s 3.1s 16.03% 21.27% 0.4 (0.7) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.9s
  • uptime_min/max:8.62% / 25.47%

Stack Uptimes

  • dreamstate_1:9.66%
  • dreamstate_2:6.37%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.3s 44.9s 20.6s 49.27% 52.50% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.11%

Stack Uptimes

  • eclipse_lunar_1:49.27%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.2s 92.68% 95.99% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.3s
  • trigger_min/max:0.0s / 55.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.41% / 95.12%

Stack Uptimes

  • eclipse_solar_1:92.68%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.9s 306.9s 27.3s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.6s 32.1s 24.9s 43.39% 43.36% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 199.2s
  • trigger_min/max:0.0s / 154.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 140.3s
  • uptime_min/max:14.06% / 83.13%

Stack Uptimes

  • friend_of_the_fae_1:43.39%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.9s 44.9s 20.3s 48.35% 51.23% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.0s
  • trigger_min/max:12.0s / 90.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 54.97%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.35%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.8s 99.8s 19.5s 23.27% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 125.9s
  • trigger_min/max:90.0s / 125.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.26% / 26.29%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.37% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.36% / 30.61%

Stack Uptimes

  • natures_grace_1:25.37%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.8s 68.9s 7.7s 6.26% 6.93% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 352.5s
  • trigger_min/max:0.0s / 352.5s
  • trigger_pct:14.94%
  • duration_min/max:0.0s / 28.1s
  • uptime_min/max:0.00% / 26.60%

Stack Uptimes

  • owlkin_frenzy_1:6.26%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 108.0 38.8s 38.8s 34.8s 93.97% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.3s / 50.5s
  • trigger_min/max:24.3s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.4s
  • uptime_min/max:90.29% / 96.77%

Stack Uptimes

  • primordial_arcanic_pulsar_4:4.99%
  • primordial_arcanic_pulsar_8:5.52%
  • primordial_arcanic_pulsar_12:6.58%
  • primordial_arcanic_pulsar_16:6.94%
  • primordial_arcanic_pulsar_20:6.47%
  • primordial_arcanic_pulsar_24:6.05%
  • primordial_arcanic_pulsar_28:7.84%
  • primordial_arcanic_pulsar_32:8.03%
  • primordial_arcanic_pulsar_36:6.59%
  • primordial_arcanic_pulsar_40:7.19%
  • primordial_arcanic_pulsar_44:6.99%
  • primordial_arcanic_pulsar_48:7.05%
  • primordial_arcanic_pulsar_52:7.28%
  • primordial_arcanic_pulsar_56:6.46%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.55% 39.78% 4.0 (4.0) 18.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.00% / 42.39%

Stack Uptimes

  • solstice_1:39.55%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.7 94.4 14.7s 2.6s 14.1s 97.24% 0.00% 53.3 (53.3) 7.6

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.8s
  • trigger_min/max:0.8s / 10.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.59% / 99.11%

Stack Uptimes

  • starlord_1:9.43%
  • starlord_2:15.42%
  • starlord_3:72.39%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.18% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 335.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 355.9s
  • uptime_min/max:71.93% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.0s 45.5s 16.5s 23.67% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 216.3s
  • trigger_min/max:0.0s / 216.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 85.7s
  • uptime_min/max:4.24% / 61.39%

Stack Uptimes

  • wafting_devotion_1:23.67%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.4s 48.4s 21.9s 44.75% 43.81% 0.0 (0.0) 2.4

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.2s
  • trigger_min/max:45.0s / 82.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.52% / 51.22%

Stack Uptimes

  • warrior_of_elune_1:21.69%
  • warrior_of_elune_2:4.84%
  • warrior_of_elune_3:18.21%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 21.0 32.1s 0.0s 154.8s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.6s 29.6s 50.5s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.85% 0.5s 0.0s 3.4s
Astral Smolder 78.00% 57.09% 93.02% 14.9s 0.0s 116.0s
Incarnation (Total) 48.35% 43.34% 54.97% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.09% 25.76% 30.47% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.33% 36.26% 50.45% 10.8s 0.0s 15.0s
No Eclipse 6.38% 3.83% 8.66% 1.5s 0.0s 3.8s
Friend of the Fae 43.39% 14.06% 83.13% 24.9s 0.0s 140.3s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.0870.00037.15543.57825.89571.141
Full Moon
New Moon
Half Moon
0.3470.00022.6965.9015.33228.193

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.184.6%56.3649.7%0.000.0%51.9745.8%
Starfire25.0692.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3440.2%0.000.0%68.7959.8%
New Moon0.040.7%0.193.1%0.000.0%5.7896.2%
Half Moon0.000.1%0.335.8%0.000.0%5.3494.1%
Full Moon0.221.9%3.1527.2%0.080.7%8.1470.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
447+470 2p_2p
Nature's BalanceAstral Power99.50198.885.48%2.000.110.06%
Full MoonAstral Power5.29264.177.28%49.950.290.11%
Half MoonAstral Power5.68136.253.75%24.000.000.00%
MoonfireAstral Power14.3485.972.37%5.990.070.09%
New MoonAstral Power6.0072.051.99%12.000.000.00%
Orbit BreakerAstral Power6.30187.885.18%29.841.030.55%
Shooting Stars (Moonfire)Astral Power94.40188.595.20%2.000.200.10%
Shooting Stars (Sunfire)Astral Power94.61189.015.21%2.000.200.10%
StarfireAstral Power27.07397.4110.95%14.682.730.68%
SunfireAstral Power17.39104.362.88%6.000.010.01%
WrathAstral Power115.511805.0249.73%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
447+470 2p_2p
StarsurgeAstral Power 115.323641.14100.00%31.5831.636449.93
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 710400.0 3225.53 3810.26 1400368.4 534994.9 -287476.7 710400.0
Astral Power 70.0 12.10 12.12 4.6 24.5 0.0 100.0

Statistics & Data Analysis

Fight Length
447+470 2p_2p Fight Length
Count 19346
Mean 299.98
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6053
5th Percentile 246.05
95th Percentile 353.76
( 95th Percentile - 5th Percentile ) 107.71
Mean Distribution
Standard Deviation 0.2488
95.00% Confidence Interval ( 299.49 - 300.46 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51123
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1023
DPS
447+470 2p_2p Damage Per Second
Count 19346
Mean 187913.82
Minimum 163693.03
Maximum 219385.13
Spread ( max - min ) 55692.10
Range [ ( max - min ) / 2 * 100% ] 14.82%
Standard Deviation 6655.6618
5th Percentile 177452.41
95th Percentile 199263.61
( 95th Percentile - 5th Percentile ) 21811.20
Mean Distribution
Standard Deviation 47.8515
95.00% Confidence Interval ( 187820.03 - 188007.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4820
0.1 Scale Factor Error with Delta=300 378152
0.05 Scale Factor Error with Delta=300 1512608
0.01 Scale Factor Error with Delta=300 37815179
Priority Target DPS
447+470 2p_2p Priority Target Damage Per Second
Count 19346
Mean 187913.82
Minimum 163693.03
Maximum 219385.13
Spread ( max - min ) 55692.10
Range [ ( max - min ) / 2 * 100% ] 14.82%
Standard Deviation 6655.6618
5th Percentile 177452.41
95th Percentile 199263.61
( 95th Percentile - 5th Percentile ) 21811.20
Mean Distribution
Standard Deviation 47.8515
95.00% Confidence Interval ( 187820.03 - 188007.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4820
0.1 Scale Factor Error with Delta=300 378152
0.05 Scale Factor Error with Delta=300 1512608
0.01 Scale Factor Error with Delta=300 37815179
DPS(e)
447+470 2p_2p Damage Per Second (Effective)
Count 19346
Mean 187913.82
Minimum 163693.03
Maximum 219385.13
Spread ( max - min ) 55692.10
Range [ ( max - min ) / 2 * 100% ] 14.82%
Damage
447+470 2p_2p Damage
Count 19346
Mean 54694012.67
Minimum 41262770.60
Maximum 71231412.36
Spread ( max - min ) 29968641.76
Range [ ( max - min ) / 2 * 100% ] 27.40%
DTPS
447+470 2p_2p Damage Taken Per Second
Count 19346
Mean 3810.75
Minimum 870.66
Maximum 7693.39
Spread ( max - min ) 6822.73
Range [ ( max - min ) / 2 * 100% ] 89.52%
HPS
447+470 2p_2p Healing Per Second
Count 19346
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
447+470 2p_2p Healing Per Second (Effective)
Count 19346
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
447+470 2p_2p Heal
Count 19346
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
447+470 2p_2p Healing Taken Per Second
Count 19346
Mean 3217.03
Minimum 635.04
Maximum 6462.13
Spread ( max - min ) 5827.09
Range [ ( max - min ) / 2 * 100% ] 90.57%
TMI
447+470 2p_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
447+470 2p_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
447+470 2p_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.48 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.52 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.13 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.12 starsurge,if=variable.starsurge_condition1
R 15.88 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.16 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 31.01 starsurge,if=variable.starsurge_condition2
Y 113.81 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYXRYYXYSWQQQYYXYYXYYOXTYXYXRYWQQQYYYYXSYYXXYXPPYQQRYQYYYYXYPPWQQSYQRUQQOQVYWQQYPPQYQSYQRYYYFQQYYPPQYQYYYRWQQSYYQETQUQQYYOYYQQQPPQJYSQYYYYWQQYYQPPQRYQYYYYQQSVQQQRTYXPOPWQQYYQYYYSXYRXYPPQFQYNQUQVQQYYYSWQQRQYYXEYYXYXTYWQYYQQRYSYYOXYXYYQQPPQQUQRYQYYYYSWQQPPQYQYQYRYYYWQQYPPQSYQYYXYORQYQYFYQVQQTYYYWQQQPKJPQUQEYXY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 447+470 2p_2p 50.0/100: 50% astral_power
Pre precombat 1 food 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 447+470 2p_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 447+470 2p_2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.940 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.878 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.723 st N incarnation_chosen_of_elune Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.723 default D potion Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.723 default E use_items Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.723 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.578 st Q starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.398 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.191 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.946 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.709 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.725 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.488 st V full_moon Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.010 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.764 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.527 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.280 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.045 st R sunfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.808 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.572 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(11), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.336 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_aerwynn(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.100 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.863 st S moonfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.626 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.626 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), best_friends_with_aerwynn(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.481 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, best_friends_with_aerwynn(7), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.302 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn(6), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.093 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.856 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.621 st X starsurge Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.385 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.149 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.912 st X starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.675 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.440 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.204 st O warrior_of_elune Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.204 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.967 st T new_moon Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.721 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.486 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.249 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.013 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.778 st R sunfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.541 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.303 st W cancel_buff Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.303 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.156 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:33.977 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:34.767 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:35.532 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:36.295 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:37.060 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:37.825 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:38.588 st S moonfire Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
0:39.352 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:40.114 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:41.104 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:42.093 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:43.086 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.078 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:45.068 st P starfire Fluffy_Pillow 24.0/100: 24% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:45.821 st P starfire Fluffy_Pillow 42.8/100: 43% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:46.575 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:47.566 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:48.677 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:49.744 st R sunfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:50.770 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
0:51.900 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
0:53.029 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:54.118 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:55.206 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:56.295 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:57.384 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:58.474 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
0:59.566 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
1:01.199 st P starfire Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:02.091 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:02.091 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:03.201 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:04.268 st S moonfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
1:05.295 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:06.049 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:07.075 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:08.065 st U half_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:09.385 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:10.376 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.368 st O warrior_of_elune Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.368 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:12.359 st V full_moon Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:14.336 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:15.327 st W cancel_buff Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:15.327 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:16.437 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:17.504 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:18.533 st P starfire Fluffy_Pillow 31.6/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:19.287 st P starfire Fluffy_Pillow 48.4/100: 48% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:20.040 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:21.067 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:22.057 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:23.047 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:24.038 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:25.027 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(3), eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:26.116 st R sunfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:27.205 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:28.295 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:29.384 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.473 default F natures_vigil 447+470 2p_2p 75.2/100: 75% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.473 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:31.693 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:32.865 st Y wrath Fluffy_Pillow 3.2/100: 3% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:33.997 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:35.126 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:35.880 st P starfire Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.806 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:37.832 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:38.823 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:39.813 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:40.729 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:41.735 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:42.743 st R sunfire Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:43.751 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:43.751 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:44.878 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:45.966 st S moonfire Fluffy_Pillow 10.0/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:47.011 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:48.056 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:49.100 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:50.144 default E use_items Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:50.144 st T new_moon Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:50.900 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:51.816 st U half_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
1:53.037 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
1:53.955 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
1:54.871 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:55.860 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:56.850 st O warrior_of_elune Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:56.850 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:57.840 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:58.831 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:59.940 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
2:01.005 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
2:02.033 st P starfire Fluffy_Pillow 4.0/100: 4% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
2:02.787 st P starfire Fluffy_Pillow 20.8/100: 21% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
2:03.541 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
2:04.531 st J sunfire Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
2:05.519 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
2:06.511 st S moonfire Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
2:07.502 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
2:08.592 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:09.683 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:10.773 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:11.863 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:12.952 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:12.952 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:14.171 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:15.343 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:16.473 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:17.601 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:18.730 st P starfire Fluffy_Pillow 13.6/100: 14% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:19.486 st P starfire Fluffy_Pillow 30.4/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:20.378 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:21.369 st R sunfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:22.360 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:23.351 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:24.342 st Y wrath Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:25.431 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:26.521 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:27.611 st Y wrath Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.699 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(52), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.918 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:31.090 st S moonfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:32.119 st V full_moon Fluffy_Pillow 24.4/100: 24% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:34.169 st Q starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:35.197 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:36.188 st Q starsurge Fluffy_Pillow 62.4/100: 62% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:37.178 st R sunfire Fluffy_Pillow 36.4/100: 36% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:38.170 st T new_moon Fluffy_Pillow 42.4/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:38.924 st Y wrath Fluffy_Pillow 54.4/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:39.915 st X starsurge Fluffy_Pillow 72.4/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:40.906 st P starfire Fluffy_Pillow 46.4/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.390 st O warrior_of_elune Fluffy_Pillow 60.4/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.390 st P starfire Fluffy_Pillow 60.4/100: 60% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:43.144 st W cancel_buff Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:43.144 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:44.253 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:45.319 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.074 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.102 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.130 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:49.219 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.309 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.400 st S moonfire Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.489 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.579 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:54.669 st R sunfire Fluffy_Pillow 59.2/100: 59% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:55.759 st X starsurge Fluffy_Pillow 69.2/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:56.851 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:57.941 st P starfire Fluffy_Pillow 45.2/100: 45% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:58.697 st P starfire Fluffy_Pillow 62.0/100: 62% astral_power natures_grace, primordial_arcanic_pulsar(36), warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:59.453 st Q starsurge Fluffy_Pillow 78.8/100: 79% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.561 default F natures_vigil 447+470 2p_2p 44.8/100: 45% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.561 st Q starsurge Fluffy_Pillow 44.8/100: 45% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:01.628 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:02.656 st N incarnation_chosen_of_elune Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:02.723 st Q starsurge Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:03.657 st U half_moon Fluffy_Pillow 6.8/100: 7% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:04.976 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:05.968 st V full_moon Fluffy_Pillow 8.8/100: 9% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:07.945 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:08.936 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:09.927 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:10.682 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:11.435 st Y wrath Fluffy_Pillow 46.8/100: 47% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:12.424 st S moonfire Fluffy_Pillow 68.8/100: 69% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:13.414 st W cancel_buff Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_urctos_static, corrupting_rage
3:13.414 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, best_friends_with_urctos_static, corrupting_rage
3:14.524 st Q starsurge Fluffy_Pillow 50.8/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_urctos_static
3:15.592 st R sunfire Fluffy_Pillow 26.8/100: 27% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
3:16.620 st Q starsurge Fluffy_Pillow 32.8/100: 33% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
3:17.649 st Y wrath Fluffy_Pillow 4.8/100: 5% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:18.641 st Y wrath Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:19.631 st X starsurge Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:20.621 default E use_items Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:20.621 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:21.610 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(100)
3:22.600 st X starsurge Fluffy_Pillow 44.8/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(95)
3:23.592 st Y wrath Fluffy_Pillow 16.8/100: 17% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(90)
3:24.583 st X starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(85)
3:25.573 st T new_moon Fluffy_Pillow 8.8/100: 9% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(80)
3:26.453 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(75)
3:27.443 st W cancel_buff Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(70)
3:27.443 st Q starsurge Fluffy_Pillow 38.8/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(70)
3:28.552 st Y wrath Fluffy_Pillow 10.8/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, best_friends_with_urctos_static, undulating_sporecloak, kindled_soul(65)
3:29.618 st Y wrath Fluffy_Pillow 26.8/100: 27% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:30.685 st Q starsurge Fluffy_Pillow 76.8/100: 77% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:31.749 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:32.776 st R sunfire Fluffy_Pillow 22.8/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:33.768 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:34.759 st S moonfire Fluffy_Pillow 48.8/100: 49% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:35.750 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:36.740 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:37.732 st O warrior_of_elune Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:37.732 st X starsurge Fluffy_Pillow 88.8/100: 89% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:38.723 st Y wrath Fluffy_Pillow 64.8/100: 65% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:39.712 st X starsurge Fluffy_Pillow 82.8/100: 83% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:40.702 st Y wrath Fluffy_Pillow 54.8/100: 55% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:41.694 st Y wrath Fluffy_Pillow 72.8/100: 73% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:42.684 st Q starsurge Fluffy_Pillow 90.8/100: 91% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:43.792 st Q starsurge Fluffy_Pillow 66.8/100: 67% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.858 st P starfire Fluffy_Pillow 40.8/100: 41% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:45.613 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:46.367 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:47.393 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:48.384 st U half_moon Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:49.585 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.419 st R sunfire Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.252 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.169 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.086 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.002 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.917 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.834 st Y wrath Fluffy_Pillow 66.4/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:56.752 st S moonfire Fluffy_Pillow 84.4/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:57.668 st W cancel_buff Fluffy_Pillow 92.4/100: 92% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:57.668 st Q starsurge Fluffy_Pillow 92.4/100: 92% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:58.696 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
3:59.682 st P starfire Fluffy_Pillow 36.4/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:00.436 st P starfire Fluffy_Pillow 55.2/100: 55% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.290 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.239 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.156 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:04.073 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
4:04.989 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak
4:05.979 st Y wrath Fluffy_Pillow 3.2/100: 3% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak
4:07.068 st R sunfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak
4:08.159 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak
4:09.250 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak
4:10.340 st Y wrath Fluffy_Pillow 65.2/100: 65% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak
4:11.428 st W cancel_buff Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
4:11.428 st Q starsurge Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak
4:12.648 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord, best_friends_with_urctos_static, undulating_sporecloak
4:13.821 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:14.952 st P starfire Fluffy_Pillow 29.2/100: 29% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:16.646 st P starfire Fluffy_Pillow 43.2/100: 43% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
4:17.570 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
4:18.598 st S moonfire Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:19.589 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:20.344 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:21.335 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:22.325 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:23.415 st X starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:24.505 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:25.594 st O warrior_of_elune Fluffy_Pillow 29.2/100: 29% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:25.594 st R sunfire Fluffy_Pillow 29.2/100: 29% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:26.684 st Q starsurge Fluffy_Pillow 67.2/100: 67% astral_power eclipse_solar, primordial_arcanic_pulsar(48), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:27.904 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:29.078 st Q starsurge Fluffy_Pillow 49.2/100: 49% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:30.252 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:31.381 default F natures_vigil 447+470 2p_2p 35.2/100: 35% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:31.381 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:32.510 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:33.639 st V full_moon Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:35.616 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:36.606 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:37.595 st T new_moon Fluffy_Pillow 25.2/100: 25% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:38.350 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:39.340 st Y wrath Fluffy_Pillow 57.2/100: 57% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:40.330 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:41.321 st W cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:41.321 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:42.430 st Q starsurge Fluffy_Pillow 63.2/100: 63% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:43.496 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:44.524 st P starfire Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:45.277 st K moonfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:46.268 st J sunfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
4:47.258 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, corrupting_rage
4:48.011 st Q starsurge Fluffy_Pillow 56.8/100: 57% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:49.003 st U half_moon Fluffy_Pillow 24.8/100: 25% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
4:50.323 st Q starsurge Fluffy_Pillow 52.8/100: 53% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:51.313 default E use_items Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:51.313 st Y wrath Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
4:52.402 st X starsurge Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
4:53.493 st Y wrath Fluffy_Pillow 8.8/100: 9% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35520 33829 30119
Intellect 2089 0 13525 12712 10018 (6121)
Spirit 0 0 0 0 0
Health 710400 710400 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13525 12712 0
Crit 27.36% 21.15% 2907
Haste 23.39% 23.39% 3768
Versatility 8.64% 3.64% 747
Mana Regen 2560 2560 0
Attack Power 14066 13220 0
Mastery 27.74% 27.74% 7045
Armor 4506 4506 4506
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 467.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 447, stats: { 456 Armor, +1796 Sta, +195 Haste, +461 Vers, +476 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 447, stats: { 373 Armor, +1796 Sta, +300 Haste, +356 Mastery, +476 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="447+470 2p_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=447
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=447
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.13
# gear_stamina=30119
# gear_intellect=10018
# gear_crit_rating=2907
# gear_haste_rating=3768
# gear_mastery_rating=7045
# gear_versatility_rating=747
# gear_armor=4506
# set_bonus=tier30_2pc=1
# set_bonus=tier31_2pc=1

460 T31_2p : 183093 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
183093.3 183093.3 91.3 / 0.050% 25535.4 / 13.9% 14626.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.7 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31_2p 183093
Astral Smolder 12280 6.7% 64.1 4.67s 57359 0 Periodic 116.4 31576 0 31576 0.0% 77.6%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.08 0.00 116.40 116.40 48.37 0.0000 2.0000 3675605.51 3675605.51 0.00% 15788.07 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.40 72 164 31575.72 8029 109915 31589.31 23411 41777 3675606 3675606 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5399) 0.0% (3.0%) 8.5 32.14s 190177 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.51 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 9325 3.0% 149.5 1.75s 10826 8356 Direct 148.5 8560 17098 10893 27.3%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.46 148.53 0.00 0.00 0.00 1.2955 0.0000 1617944.44 1617944.44 0.00% 8356.24 8356.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.67% 107.94 20 286 8559.85 5681 14771 8552.16 7555 10407 923946 923946 0.00%
crit 27.33% 40.59 4 120 17097.53 12684 29543 17086.47 14669 21579 693999 693999 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.277
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:14262.50
Hungering Shadowflame 3022 1.7% 17.2 16.95s 52776 0 Direct 17.2 41490 82771 52776 27.3%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.17 17.17 0.00 0.00 0.00 0.0000 0.0000 905974.14 905974.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 12.47 2 29 41489.64 27654 160477 41362.35 27835 96544 517501 517501 0.00%
crit 27.34% 4.69 0 17 82771.04 55309 320954 81714.05 0 317658 388473 388473 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2896 1.6% 34.0 8.64s 25531 0 Direct 33.9 20097 40165 25602 27.4%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.99 33.89 0.00 0.00 0.00 0.0000 0.0000 867764.43 867764.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.57% 24.60 8 45 20096.75 19574 22717 20096.43 19789 20875 494298 494298 0.00%
crit 27.43% 9.30 0 24 40165.44 39147 45434 40161.76 0 43449 373466 373466 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10435 5.7% 14.3 21.60s 218023 224373 Direct 14.3 7770 15809 10535 34.4%
Periodic 308.9 7005 14510 9626 34.9% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 308.94 308.94 13.33 0.9718 0.9658 3124836.76 3124836.76 0.00% 10005.59 224372.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.61% 9.40 2 16 7770.08 5285 13925 7765.23 6618 9706 73068 73068 0.00%
crit 34.39% 4.93 0 13 15809.47 11628 27849 15756.37 0 24699 77924 77924 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.08% 201.06 140 271 7005.23 43 12715 7007.05 6596 7407 1408452 1408452 0.00%
crit 34.92% 107.88 63 158 14509.98 1069 25429 14516.01 13548 16103 1565392 1565392 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (16976) 0.0% (9.3%) 17.0 17.97s 299718 250786

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.97 0.00 0.00 0.00 0.00 1.1952 0.0000 0.00 0.00 0.00% 250785.89 250785.89

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6132 3.4% 5.3 63.11s 348315 187788 Direct 5.3 241974 477999 350327 45.9%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8549 0.0000 1842196.05 1842196.05 0.00% 187787.57 187787.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 54.10% 2.84 0 6 241974.04 162187 395783 237718.91 0 382806 688299 688299 0.00%
crit 45.90% 2.41 0 6 477998.76 328240 827266 456279.47 0 753264 1153897 1153897 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4601 2.5% 6.0 53.60s 229085 303678 Direct 6.0 151078 318765 230446 47.3%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.97 0.00 0.00 0.00 0.7545 0.0000 1375359.26 1375359.26 0.00% 303678.35 303678.35
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.68% 3.14 0 7 151078.44 83179 236220 149174.45 0 229751 475005 475005 0.00%
crit 47.32% 2.82 0 7 318765.49 166358 472440 314363.10 0 472440 900354 900354 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6244 3.4% 5.7 57.85s 329146 269183 Direct 5.6 215145 429563 331059 54.1%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.64 0.00 0.00 0.00 1.2228 0.0000 1868131.83 1868131.83 0.00% 269183.26 269183.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.94% 2.59 0 7 215144.83 119570 344694 207886.28 0 344694 557648 557648 0.00%
crit 54.06% 3.05 0 7 429562.69 243413 679901 423474.76 0 637173 1310484 1310484 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (16052) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 5991 3.3% 94.4 3.17s 19016 0 Direct 94.1 12951 26943 19068 43.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.39 94.13 0.00 0.00 0.00 0.0000 0.0000 1794925.03 1794925.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.28% 52.98 24 97 12951.07 8380 24944 12952.39 11626 14531 686119 686119 0.00%
crit 43.72% 41.15 18 68 26943.14 16760 49888 26949.32 23899 31131 1108806 1108806 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6009 3.3% 94.8 3.16s 18995 0 Direct 94.5 12937 26917 19048 43.7%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.80 94.54 0.00 0.00 0.00 0.0000 0.0000 1800733.58 1800733.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.29% 53.22 23 92 12936.75 8380 24944 12936.80 11709 14840 688425 688425 0.00%
crit 43.71% 41.32 17 75 26916.87 16760 49888 26922.58 23668 30570 1112308 1112308 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4052 2.2% 6.3 48.25s 192629 0 Direct 6.3 130857 272300 193227 44.1%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.30 6.28 0.00 0.00 0.00 0.0000 0.0000 1214055.46 1214055.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.91% 3.51 0 8 130856.78 84619 248180 129959.66 0 224885 459691 459691 0.00%
crit 44.09% 2.77 0 8 272299.92 172181 496811 264812.69 0 481567 754365 754365 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5059 2.8% 26.1 11.49s 58254 64786 Direct 27.1 39988 79983 56103 40.3%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.07 27.07 0.00 0.00 0.00 0.8992 0.0000 1518710.17 1518710.17 0.00% 64785.86 64785.86
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.71% 16.16 5 29 39988.27 17626 73581 40001.01 32117 47483 646364 646364 0.00%
crit 40.29% 10.91 0 24 79982.72 35253 145843 79989.90 0 103458 872346 872346 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.13
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 58677 (79265) 32.0% (43.3%) 115.2 2.59s 205882 207754 Direct 115.0 (152.8) 105672 218556 152716 41.7% (42.2%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.22 114.98 0.00 0.00 0.00 0.9910 0.0000 17559330.71 17559330.71 0.00% 207754.34 207754.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.32% 67.06 35 98 105671.59 75783 198285 105688.98 97522 116269 7086418 7086418 0.00%
crit 41.68% 47.92 24 75 218555.59 153217 396570 218669.30 198607 244670 10472913 10472913 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.06
  • if_expr:variable.starsurge_condition1
    st
    [X]:31.17
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20587 11.2% 38.0 7.69s 161995 0 Direct 37.9 111229 229284 162793 43.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.05 37.86 0.00 0.00 0.00 0.0000 0.0000 6163306.82 6163306.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.32% 21.32 5 45 111229.39 80106 207338 111243.92 95714 138574 2371724 2371724 0.00%
crit 43.68% 16.54 3 35 229283.75 160212 414676 229396.11 185117 291478 3791583 3791583 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10277 5.6% 17.4 18.04s 177092 181783 Direct 17.4 7615 15398 10587 38.2%
Periodic 309.9 6758 13692 9341 37.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 309.91 309.91 16.38 0.9742 0.9658 3079038.33 3079038.33 0.00% 9735.78 181782.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.82% 10.75 2 19 7615.43 4805 12951 7606.54 6313 8985 81851 81851 0.00%
crit 38.18% 6.64 0 16 15397.58 9610 26572 15385.25 0 20860 102220 102220 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.74% 194.44 134 259 6757.70 957 11559 6756.49 6355 7091 1313933 1313933 0.00%
crit 37.26% 115.48 70 169 13691.60 577 23118 13691.43 12761 14646 1581034 1581034 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.51
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.88
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3220) 0.0% (1.8%) 8.5 31.18s 113652 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1675 0.9% 8.5 31.18s 59125 0 Direct 8.5 46429 92780 59124 27.4%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.49 8.49 0.00 0.00 0.00 0.0000 0.0000 502110.61 502110.61 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.61% 6.17 0 17 46428.74 45178 52434 46407.09 0 52434 286287 286287 0.00%
crit 27.39% 2.33 0 10 92779.66 90357 104867 84173.71 0 104867 215823 215823 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1545 0.8% 16.5 15.16s 28111 0 Direct 16.5 22080 44129 28111 27.4%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 0.00 0.0000 0.0000 463063.14 463063.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.65% 11.97 1 32 22080.50 21497 24950 22080.50 21572 24351 264239 264239 0.00%
crit 27.35% 4.51 0 16 44129.38 42995 49900 43537.32 0 49900 198824 198824 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 18215 9.9% 115.6 2.53s 47168 49687 Direct 115.2 31820 65450 47340 46.2%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.65 115.23 0.00 0.00 0.00 0.9493 0.0000 5454891.51 5454891.51 0.00% 49687.49 49687.49
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.85% 62.05 36 96 31820.08 13091 106023 31817.76 28369 35909 1974327 1974327 0.00%
crit 46.15% 53.18 27 81 65449.81 26182 198963 65457.40 56712 75947 3480564 3480564 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.95

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 184.57s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 61.22s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.67 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.30s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 307.11s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.44s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.6 1.5 36.5s 33.8s 8.6s 24.91% 28.77% 1.5 (7.1) 8.4

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.4s
  • trigger_min/max:2.7s / 49.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:21.87% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.04%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.39%
  • balance_of_all_things_arcane_8:3.40%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.43% 54.48% 3.5 (20.1) 17.4

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.9s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.0s
  • uptime_min/max:45.81% / 54.19%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.94%
  • balance_of_all_things_nature_3:6.06%
  • balance_of_all_things_nature_4:6.18%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.5s 70.5s 10.8s 9.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 329.0s
  • trigger_min/max:12.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 39.08%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.89%
  • best_friends_with_aerwynn_2:0.89%
  • best_friends_with_aerwynn_3:0.89%
  • best_friends_with_aerwynn_4:0.90%
  • best_friends_with_aerwynn_5:0.90%
  • best_friends_with_aerwynn_6:0.90%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.91%
  • best_friends_with_aerwynn_9:0.91%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.92%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.9s 70.5s 45.4s 33.19% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 351.8s
  • trigger_min/max:12.0s / 329.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 335.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.19%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.3s 70.3s 10.8s 10.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 341.3s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.52%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.91%
  • best_friends_with_pip_3:0.91%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.92%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.93%
  • best_friends_with_pip_9:0.93%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 113.4s 70.3s 45.7s 33.58% 0.00% 69.9 (69.9) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 350.8s
  • trigger_min/max:12.0s / 341.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.58%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.4s 70.4s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 338.7s
  • trigger_min/max:12.0s / 338.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 40.14%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.4s 70.4s 45.4s 33.23% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:13.0s / 349.3s
  • trigger_min/max:12.0s / 338.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 339.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.23%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.3s 50.0s 80.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 345.0s
  • trigger_min/max:15.0s / 327.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.1s
  • uptime_min/max:45.30% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.12%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.2s 32.1s 41.2s 57.25% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 336.9s
  • trigger_min/max:0.0s / 147.0s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 275.5s
  • uptime_min/max:19.27% / 95.29%

Stack Uptimes

  • denizen_of_the_dream_1:38.64%
  • denizen_of_the_dream_2:14.37%
  • denizen_of_the_dream_3:3.52%
  • denizen_of_the_dream_4:0.63%
  • denizen_of_the_dream_5:0.09%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.02%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.4 20.1s 20.7s 3.1s 15.98% 21.24% 0.4 (0.8) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.7s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 19.9s
  • uptime_min/max:8.40% / 27.59%

Stack Uptimes

  • dreamstate_1:9.65%
  • dreamstate_2:6.32%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.2s 44.8s 20.6s 49.32% 52.52% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.5s
  • trigger_min/max:12.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.13%

Stack Uptimes

  • eclipse_lunar_1:49.32%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.1s 92.74% 96.01% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.5s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.04% / 94.92%

Stack Uptimes

  • eclipse_solar_1:92.74%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.20% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.88% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.20%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.4s 32.1s 24.8s 43.40% 43.35% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 180.2s
  • trigger_min/max:0.0s / 147.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 154.5s
  • uptime_min/max:14.40% / 84.32%

Stack Uptimes

  • friend_of_the_fae_1:43.40%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.8s 44.8s 20.3s 48.40% 51.26% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.5s
  • trigger_min/max:12.0s / 90.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.40%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.7s 99.7s 19.5s 23.26% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 125.4s
  • trigger_min/max:90.0s / 125.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.29% / 26.26%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.40% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.4s
  • trigger_min/max:12.8s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.50% / 30.37%

Stack Uptimes

  • natures_grace_1:25.40%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 91.9s
  • trigger_min/max:90.0s / 91.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.03%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.3s 68.3s 7.7s 6.26% 6.95% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 336.9s
  • trigger_min/max:0.0s / 336.9s
  • trigger_pct:14.97%
  • duration_min/max:0.0s / 30.6s
  • uptime_min/max:0.00% / 27.32%

Stack Uptimes

  • owlkin_frenzy_1:6.26%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 108.1 38.8s 38.8s 34.7s 94.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.5s / 51.1s
  • trigger_min/max:24.5s / 51.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s
  • uptime_min/max:90.41% / 96.68%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.01%
  • primordial_arcanic_pulsar_8:5.52%
  • primordial_arcanic_pulsar_12:6.58%
  • primordial_arcanic_pulsar_16:6.92%
  • primordial_arcanic_pulsar_20:6.48%
  • primordial_arcanic_pulsar_24:6.05%
  • primordial_arcanic_pulsar_28:7.79%
  • primordial_arcanic_pulsar_32:8.05%
  • primordial_arcanic_pulsar_36:6.60%
  • primordial_arcanic_pulsar_40:7.20%
  • primordial_arcanic_pulsar_44:6.99%
  • primordial_arcanic_pulsar_48:7.03%
  • primordial_arcanic_pulsar_52:7.31%
  • primordial_arcanic_pulsar_56:6.48%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.58% 39.82% 4.0 (4.0) 18.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.7s
  • trigger_min/max:0.0s / 40.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.04% / 42.43%

Stack Uptimes

  • solstice_1:39.58%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.7 94.5 14.7s 2.6s 14.1s 97.25% 0.00% 53.4 (53.4) 7.7

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.7s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.70% / 99.12%

Stack Uptimes

  • starlord_1:9.40%
  • starlord_2:15.36%
  • starlord_3:72.48%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.9s 5.5s 43.2s 90.18% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 340.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 349.2s
  • uptime_min/max:69.25% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.2s 45.6s 16.5s 23.70% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 222.6s
  • trigger_min/max:0.0s / 209.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 90.2s
  • uptime_min/max:4.95% / 60.80%

Stack Uptimes

  • wafting_devotion_1:23.70%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.4s 48.4s 21.9s 44.66% 43.73% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:33.31% / 50.91%

Stack Uptimes

  • warrior_of_elune_1:21.49%
  • warrior_of_elune_2:4.93%
  • warrior_of_elune_3:18.24%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 23.0 32.1s 0.0s 147.0s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.5s 29.3s 49.9s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.49% 0.5s 0.0s 3.4s
Astral Smolder 77.87% 55.32% 93.63% 14.9s 0.0s 118.0s
Incarnation (Total) 48.40% 43.34% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.13% 25.72% 30.49% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.13% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.34% 36.06% 50.50% 10.8s 0.0s 15.0s
No Eclipse 6.32% 4.11% 8.60% 1.5s 0.0s 3.7s
Friend of the Fae 43.40% 14.40% 84.32% 24.8s 0.0s 154.5s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.1120.00036.98143.68126.15772.389
Full Moon
New Moon
Half Moon
0.3470.00021.1745.8875.33027.521

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.194.6%56.4549.7%0.000.0%52.0145.8%
Starfire25.0792.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3540.2%0.000.0%68.8859.8%
New Moon0.040.7%0.193.2%0.000.0%5.7796.2%
Half Moon0.000.1%0.335.9%0.000.0%5.3494.1%
Full Moon0.221.9%3.1527.1%0.080.7%8.1570.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31_2p
Nature's BalanceAstral Power99.45198.785.47%2.000.110.06%
Full MoonAstral Power5.29264.137.27%49.950.290.11%
Half MoonAstral Power5.68136.233.75%24.000.000.00%
MoonfireAstral Power14.3385.932.37%6.000.060.07%
New MoonAstral Power6.0072.041.98%12.000.000.00%
Orbit BreakerAstral Power6.30188.085.18%29.841.000.53%
Shooting Stars (Moonfire)Astral Power94.39188.595.19%2.000.200.10%
Shooting Stars (Sunfire)Astral Power94.80189.405.21%2.000.200.10%
StarfireAstral Power27.07397.4610.94%14.682.800.70%
SunfireAstral Power17.39104.302.87%6.000.010.01%
WrathAstral Power115.651807.2549.76%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31_2p
StarsurgeAstral Power 115.413643.96100.00%31.5731.626510.13
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 719520.0 3228.76 3842.62 1335509.7 535460.1 -434971.4 719520.0
Astral Power 70.0 12.11 12.13 4.7 24.2 0.0 100.0

Statistics & Data Analysis

Fight Length
460 T31_2p Fight Length
Count 19728
Mean 299.84
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.7678
5th Percentile 246.00
95th Percentile 354.19
( 95th Percentile - 5th Percentile ) 108.19
Mean Distribution
Standard Deviation 0.2475
95.00% Confidence Interval ( 299.35 - 300.32 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 517
0.1% Error 51651
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1032
DPS
460 T31_2p Damage Per Second
Count 19728
Mean 183093.29
Minimum 159963.54
Maximum 212522.42
Spread ( max - min ) 52558.88
Range [ ( max - min ) / 2 * 100% ] 14.35%
Standard Deviation 6544.0073
5th Percentile 172804.29
95th Percentile 194245.56
( 95th Percentile - 5th Percentile ) 21441.27
Mean Distribution
Standard Deviation 46.5910
95.00% Confidence Interval ( 183001.98 - 183184.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4908
0.1 Scale Factor Error with Delta=300 365571
0.05 Scale Factor Error with Delta=300 1462283
0.01 Scale Factor Error with Delta=300 36557056
Priority Target DPS
460 T31_2p Priority Target Damage Per Second
Count 19728
Mean 183093.29
Minimum 159963.54
Maximum 212522.42
Spread ( max - min ) 52558.88
Range [ ( max - min ) / 2 * 100% ] 14.35%
Standard Deviation 6544.0073
5th Percentile 172804.29
95th Percentile 194245.56
( 95th Percentile - 5th Percentile ) 21441.27
Mean Distribution
Standard Deviation 46.5910
95.00% Confidence Interval ( 183001.98 - 183184.61 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4908
0.1 Scale Factor Error with Delta=300 365571
0.05 Scale Factor Error with Delta=300 1462283
0.01 Scale Factor Error with Delta=300 36557056
DPS(e)
460 T31_2p Damage Per Second (Effective)
Count 19728
Mean 183093.29
Minimum 159963.54
Maximum 212522.42
Spread ( max - min ) 52558.88
Range [ ( max - min ) / 2 * 100% ] 14.35%
Damage
460 T31_2p Damage
Count 19728
Mean 53210033.35
Minimum 39645096.88
Maximum 68183734.46
Spread ( max - min ) 28538637.59
Range [ ( max - min ) / 2 * 100% ] 26.82%
DTPS
460 T31_2p Damage Taken Per Second
Count 19728
Mean 3844.13
Minimum 1017.07
Maximum 8086.38
Spread ( max - min ) 7069.31
Range [ ( max - min ) / 2 * 100% ] 91.95%
HPS
460 T31_2p Healing Per Second
Count 19728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31_2p Healing Per Second (Effective)
Count 19728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31_2p Heal
Count 19728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31_2p Healing Taken Per Second
Count 19728
Mean 3220.24
Minimum 628.46
Maximum 6460.05
Spread ( max - min ) 5831.59
Range [ ( max - min ) / 2 * 100% ] 90.55%
TMI
460 T31_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.51 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.13 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.06 starsurge,if=variable.starsurge_condition1
R 15.88 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.13 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 31.17 starsurge,if=variable.starsurge_condition2
Y 113.95 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYXRYXYYSWQQQYYYYXYYXOTYXYXYRWQQQYYQYYYYXXSXYXYPPQQRYQYYYYXYXYPPQQSUQRQVOYXXYYPPQQYQSYRYXYYFXXYPPQYQYYQYRYSYXYPPQEQQTUQOYQYRYXYPPYQQSYQYYYYXYRWQPPQYQYQYSYXYYWQQRQVQTOYYXXYPPYQQSYQRYYYXFYXYNUYQQQVQYYRSXQYXYWQQYQEYYTYXYYXRYWQQQSYYOYYXYXYXPPYWQQRUQQYYQSYYXYPPQQYYQQRYYYXYXPPQSYQYQRYOYYFYXYWQQVQQTSYRXXPPWQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31_2p 50.0/100: 50% astral_power
Pre precombat 1 food 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31_2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.942 st K moonfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.878 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.721 st N incarnation_chosen_of_elune Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.721 default D potion Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.721 default E use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.721 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.573 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.393 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.185 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_pip(11), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.941 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), best_friends_with_pip(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.707 st U half_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_pip(10), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.721 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), best_friends_with_pip(9), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:08.482 st V full_moon Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), best_friends_with_pip(8), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.002 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_pip(6), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.757 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), dreamstate, best_friends_with_pip(6), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.519 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.274 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_pip(4), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.037 st R sunfire Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.801 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.563 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.326 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.088 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.852 st S moonfire Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.616 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.616 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.469 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.291 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.082 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.844 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.607 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.372 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.134 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:23.897 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:24.659 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), corrupting_rage, elemental_potion_of_ultimate_power
0:25.422 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.177 st O warrior_of_elune Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.177 st T new_moon Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.932 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:27.685 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:28.439 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.193 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:29.947 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:30.702 st R sunfire Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.457 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:31.457 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:32.245 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:33.002 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:33.758 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:34.512 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:35.266 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:36.019 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:36.775 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:37.529 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:38.283 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:39.038 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:39.792 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), wafting_devotion, corrupting_rage
0:40.546 st S moonfire Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:41.462 st X starsurge Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:42.376 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:43.291 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:44.205 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), undulating_sporecloak, wafting_devotion, corrupting_rage
0:45.120 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, wafting_devotion, corrupting_rage
0:45.874 st P starfire Fluffy_Pillow 66.8/100: 67% astral_power denizen_of_the_dream(4), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), undulating_sporecloak, wafting_devotion, corrupting_rage
0:46.628 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, warrior_of_elune, undulating_sporecloak, wafting_devotion, corrupting_rage
0:47.653 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord, warrior_of_elune, undulating_sporecloak, wafting_devotion, corrupting_rage
0:48.639 st R sunfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, undulating_sporecloak, wafting_devotion, corrupting_rage
0:49.587 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, undulating_sporecloak, wafting_devotion, corrupting_rage
0:50.535 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(11), wafting_devotion, corrupting_rage
0:51.484 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip(11), wafting_devotion, corrupting_rage
0:52.491 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(10), corrupting_rage
0:53.581 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(8), corrupting_rage
0:54.671 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(7), corrupting_rage
0:55.761 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(6), undulating_sporecloak, corrupting_rage
0:56.848 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip(5), undulating_sporecloak, corrupting_rage
0:57.937 st X starsurge Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip(4), undulating_sporecloak, corrupting_rage
0:59.026 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip(3), undulating_sporecloak, corrupting_rage
1:00.112 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip(2), undulating_sporecloak, corrupting_rage
1:01.741 st P starfire Fluffy_Pillow 59.6/100: 60% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), dreamstate, undulating_sporecloak, corrupting_rage
1:02.738 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, dreamstate, undulating_sporecloak, corrupting_rage
1:03.846 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, dreamstate, undulating_sporecloak, corrupting_rage
1:04.911 st S moonfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
1:05.844 st U half_moon Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, solstice, starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
1:07.086 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, solstice, starlord(2), dreamstate, undulating_sporecloak, corrupting_rage
1:08.113 st R sunfire Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:09.104 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:10.094 st V full_moon Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:12.069 st O warrior_of_elune Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage
1:12.069 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
1:12.824 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
1:13.814 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
1:14.802 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
1:15.790 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), undulating_sporecloak, corrupting_rage
1:16.780 st P starfire Fluffy_Pillow 51.6/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, corrupting_rage
1:17.535 st P starfire Fluffy_Pillow 68.4/100: 68% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(2), undulating_sporecloak, corrupting_rage
1:18.290 st Q starsurge Fluffy_Pillow 87.2/100: 87% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, undulating_sporecloak, corrupting_rage
1:19.397 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, undulating_sporecloak, corrupting_rage
1:20.463 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:21.491 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:22.519 st S moonfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:23.610 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:24.698 st R sunfire Fluffy_Pillow 63.2/100: 63% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:25.786 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:26.875 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:27.964 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:29.051 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:30.139 default F natures_vigil 460 T31_2p 87.2/100: 87% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:30.139 st X starsurge Fluffy_Pillow 87.2/100: 87% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, undulating_sporecloak, corrupting_rage
1:31.228 st X starsurge Fluffy_Pillow 51.2/100: 51% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:32.318 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:33.405 st P starfire Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), warrior_of_elune, dreamstate, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:34.159 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power natures_vigil, denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:35.156 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.262 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:37.327 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:38.395 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:39.421 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:40.549 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:41.677 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:42.766 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:43.856 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:44.942 st S moonfire Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:46.031 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:47.119 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:48.207 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:49.294 st P starfire Fluffy_Pillow 62.0/100: 62% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:50.925 st P starfire Fluffy_Pillow 76.0/100: 76% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:51.924 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:53.032 default E use_items Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:53.032 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:54.001 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:54.933 st T new_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:55.687 st U half_moon Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(90)
1:56.886 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(85)
1:57.875 st O warrior_of_elune Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
1:57.875 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(80)
1:58.629 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(75)
1:59.618 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(70)
2:00.607 st R sunfire Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
2:01.596 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
2:02.585 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
2:03.574 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
2:04.562 st P starfire Fluffy_Pillow 34.0/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(45)
2:05.316 st P starfire Fluffy_Pillow 50.8/100: 51% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(40)
2:06.069 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(35)
2:07.059 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(30)
2:08.167 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(25)
2:09.233 st S moonfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(20)
2:10.259 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(15)
2:11.386 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(10)
2:12.514 st Y wrath Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, kindled_soul(5)
2:13.601 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:14.690 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:15.778 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:16.866 st X starsurge Fluffy_Pillow 77.6/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:17.954 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
2:19.042 st R sunfire Fluffy_Pillow 61.6/100: 62% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:20.131 st W cancel_buff Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:20.131 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(36), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:21.351 st P starfire Fluffy_Pillow 35.6/100: 36% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord, warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:22.104 st P starfire Fluffy_Pillow 52.4/100: 52% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:23.064 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:24.129 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:25.154 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:26.180 st Y wrath Fluffy_Pillow 16.4/100: 16% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:27.167 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:28.255 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:29.344 st S moonfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:30.433 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
2:31.522 st X starsurge Fluffy_Pillow 46.4/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
2:32.612 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
2:33.702 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage
2:34.790 st W cancel_buff Fluffy_Pillow 78.4/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:34.790 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power eclipse_solar, primordial_arcanic_pulsar(56), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage
2:36.008 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:37.075 st R sunfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:38.103 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:39.129 st V full_moon Fluffy_Pillow 6.4/100: 6% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:41.104 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:42.093 st T new_moon Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:42.846 st O warrior_of_elune Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:42.875 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak
2:43.863 st Y wrath Fluffy_Pillow 60.4/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
2:44.780 st X starsurge Fluffy_Pillow 76.4/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:45.696 st X starsurge Fluffy_Pillow 50.4/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:46.612 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:47.529 st P starfire Fluffy_Pillow 36.4/100: 36% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:48.284 st P starfire Fluffy_Pillow 55.2/100: 55% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:49.039 st Y wrath Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:49.954 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:50.977 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:51.963 st S moonfire Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:52.911 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:53.954 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:55.000 st R sunfire Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:56.006 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion
2:57.011 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:58.016 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:59.023 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.112 default F natures_vigil 460 T31_2p 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:00.139 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:01.227 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:02.315 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:03.405 st N incarnation_chosen_of_elune Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:03.405 st U half_moon Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:04.604 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:05.359 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, warrior_of_elune, dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:06.366 st Q starsurge Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, warrior_of_elune, dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:07.335 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), warrior_of_elune, dreamstate, best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:08.269 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate, best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:10.066 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:11.056 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:11.811 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:12.800 st R sunfire Fluffy_Pillow 70.0/100: 70% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:13.790 st S moonfire Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:14.779 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:15.771 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:16.761 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:17.751 st X starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:18.739 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:19.729 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:19.729 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:20.837 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:21.902 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:22.928 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:23.954 default E use_items Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:23.954 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:24.942 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:25.931 st T new_moon Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:26.684 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:27.673 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:28.663 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:29.652 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:30.644 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
3:31.558 st R sunfire Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
3:32.472 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
3:33.389 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
3:33.389 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
3:34.412 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
3:35.398 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(45)
3:36.349 st S moonfire Fluffy_Pillow 6.0/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
3:37.264 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
3:38.179 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
3:39.095 st O warrior_of_elune Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:39.095 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:40.011 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:40.927 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:41.843 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:42.758 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
3:43.673 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
3:44.590 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:45.506 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.260 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.015 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.930 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.930 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:48.953 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(56), solstice, starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:49.939 st R sunfire Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.803 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, owlkin_frenzy, solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.953 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.900 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.816 st Y wrath Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.733 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.648 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.564 st S moonfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:57.554 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:58.542 st Y wrath Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:59.532 st X starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
4:00.521 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
4:01.510 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
4:02.264 st P starfire Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:03.155 st Q starsurge Fluffy_Pillow 78.4/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, best_friends_with_urctos_static, undulating_sporecloak
4:04.264 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, best_friends_with_urctos_static, undulating_sporecloak
4:05.331 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak
4:06.357 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak
4:07.382 st Q starsurge Fluffy_Pillow 84.4/100: 84% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), solstice, starlord(2), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak
4:08.513 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak
4:09.601 st R sunfire Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak
4:10.689 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak
4:11.776 st Y wrath Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:12.864 st Y wrath Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:13.954 st X starsurge Fluffy_Pillow 82.4/100: 82% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:15.041 st Y wrath Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:16.129 st X starsurge Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:17.218 st P starfire Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:18.847 st P starfire Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:19.844 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:20.952 st S moonfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:22.018 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:22.773 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:23.838 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:24.866 st Q starsurge Fluffy_Pillow 40.4/100: 40% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:25.995 st R sunfire Fluffy_Pillow 4.4/100: 4% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:27.085 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:28.171 st O warrior_of_elune Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:28.171 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:29.260 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:30.351 default F natures_vigil 460 T31_2p 62.4/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:30.351 st Y wrath Fluffy_Pillow 62.4/100: 62% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:31.441 st X starsurge Fluffy_Pillow 78.4/100: 78% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:32.529 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:33.619 st W cancel_buff Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:33.619 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(56), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:34.838 st Q starsurge Fluffy_Pillow 32.4/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:35.903 st V full_moon Fluffy_Pillow 6.4/100: 6% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:37.951 st Q starsurge Fluffy_Pillow 64.4/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:38.978 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:39.967 st T new_moon Fluffy_Pillow 16.4/100: 16% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:40.724 st S moonfire Fluffy_Pillow 28.4/100: 28% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:41.716 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:42.705 st R sunfire Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:43.696 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:44.686 st X starsurge Fluffy_Pillow 32.4/100: 32% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak
4:45.674 st P starfire Fluffy_Pillow 6.4/100: 6% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
4:46.429 st P starfire Fluffy_Pillow 23.2/100: 23% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
4:47.183 st W cancel_buff Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
4:47.183 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35976 34263 30553
Intellect 2089 0 13622 12804 10106 (6209)
Spirit 0 0 0 0 0
Health 719520 719520 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13622 12804 0
Crit 27.22% 21.01% 2881
Haste 23.52% 23.52% 3791
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14167 13316 0
Mastery 27.77% 27.77% 7056
Armor 4552 4552 4552
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 469.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=468.75
# gear_stamina=30553
# gear_intellect=10106
# gear_crit_rating=2881
# gear_haste_rating=3791
# gear_mastery_rating=7056
# gear_versatility_rating=793
# gear_armor=4552
# set_bonus=tier31_2pc=1

460 T31_4p : 197642 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
197642.5 197642.5 98.7 / 0.050% 29537.8 / 14.9% 15755.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.6 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
460 T31_4p 197642
Astral Smolder 14261 7.2% 64.0 4.60s 66680 0 Periodic 116.4 36688 0 36688 0.0% 77.6%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.04 0.00 116.39 116.39 48.31 0.0000 2.0000 4270256.15 4270256.15 0.00% 18344.21 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.39 74 161 36687.86 7950 131476 36696.65 27349 46801 4270256 4270256 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (6341) 0.0% (3.2%) 8.5 31.60s 222689 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.54 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 10960 3.2% 149.9 1.71s 12682 9783 Direct 149.0 10027 20027 12761 27.3%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.90 148.97 0.00 0.00 0.00 1.2963 0.0000 1900995.38 1900995.38 0.00% 9783.31 9783.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 108.24 21 295 10026.70 6544 17329 10017.82 8936 11916 1085340 1085340 0.00%
crit 27.34% 40.73 5 119 20027.47 13088 34145 20013.10 17569 25581 815656 815656 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.104
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16613.22
Hungering Shadowflame 3032 1.5% 17.2 16.72s 52867 0 Direct 17.2 41376 83209 52866 27.5%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.21 17.21 0.00 0.00 0.00 0.0000 0.0000 910105.55 910105.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 12.49 2 31 41376.07 27630 160353 41232.37 27790 92943 516630 516630 0.00%
crit 27.47% 4.73 0 15 83209.38 55259 320706 82493.58 0 320706 393475 393475 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2891 1.5% 34.0 8.69s 25496 0 Direct 33.9 20081 40133 25565 27.3%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 33.98 33.89 0.00 0.00 0.00 0.0000 0.0000 866480.06 866480.06 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.66% 24.63 9 46 20081.30 19556 22699 20080.94 19753 20868 494525 494525 0.00%
crit 27.34% 9.27 0 25 40132.59 39112 45399 40128.25 0 43360 371956 371956 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10761 5.4% 14.3 21.60s 224746 231144 Direct 14.3 7961 16319 10828 34.3%
Periodic 308.7 7197 15030 9934 35.0% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 308.71 308.71 13.34 0.9723 0.9667 3222149.93 3222149.93 0.00% 10314.77 231144.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.69% 9.42 2 17 7961.20 5264 14872 7955.47 6534 9981 74977 74977 0.00%
crit 34.31% 4.92 0 14 16318.72 10467 29161 16263.60 0 27475 80276 80276 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 65.05% 200.82 137 271 7196.64 167 13089 7200.42 6789 7751 1445208 1445208 0.00%
crit 34.95% 107.90 62 155 15030.17 529 26179 15039.85 13975 16499 1621689 1621689 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.26
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (18750) 0.0% (9.5%) 17.0 17.96s 331068 276799

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.97 0.00 0.00 0.00 0.00 1.1961 0.0000 0.00 0.00 0.00% 276799.49 276799.49

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6802 3.5% 5.3 63.25s 386380 208130 Direct 5.3 269234 528695 388658 46.0%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8565 0.0000 2043213.96 2043213.96 0.00% 208130.18 208130.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.97% 2.84 0 6 269234.38 163271 454423 264031.85 0 441440 763890 763890 0.00%
crit 46.03% 2.42 0 6 528695.16 332225 908634 504918.52 0 857698 1279324 1279324 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 5166 2.6% 6.0 53.57s 257210 340947 Direct 6.0 170933 356439 258911 47.4%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.96 0.00 0.00 0.00 0.7545 0.0000 1544151.12 1544151.12 0.00% 340947.48 340947.48
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 52.57% 3.14 0 7 170932.60 83786 264120 168940.68 0 259556 535942 535942 0.00%
crit 47.43% 2.83 0 7 356439.22 163725 526867 351112.96 0 502600 1008209 1008209 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6783 3.4% 5.7 57.72s 357659 292257 Direct 5.6 234511 466174 359646 54.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.64 0.00 0.00 0.00 1.2239 0.0000 2029726.96 2029726.96 0.00% 292257.30 292257.30
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.98% 2.59 0 7 234510.65 118314 379983 226931.01 0 373816 608489 608489 0.00%
crit 54.02% 3.05 0 7 466174.20 232580 759966 459323.47 0 739149 1421238 1421238 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (17354) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6485 3.3% 94.4 3.15s 20575 0 Direct 94.2 13959 29218 20631 43.7%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.43 94.17 0.00 0.00 0.00 0.0000 0.0000 1942876.82 1942876.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.27% 52.99 25 89 13958.56 8292 27866 13963.29 12288 16137 739717 739717 0.00%
crit 43.73% 41.18 17 72 29217.77 16584 55732 29231.16 25701 34266 1203160 1203160 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6494 3.3% 94.7 3.15s 20551 0 Direct 94.4 13945 29184 20607 43.7%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.67 94.42 0.00 0.00 0.00 0.0000 0.0000 1945627.67 1945627.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.28% 53.14 25 89 13945.12 8292 27866 13949.37 12173 15904 741046 741046 0.00%
crit 43.72% 41.28 17 71 29183.68 16584 55732 29198.80 24357 34315 1204582 1204582 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4376 2.2% 6.3 48.01s 207950 0 Direct 6.3 141174 295761 208615 43.6%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.31 6.29 0.00 0.00 0.00 0.0000 0.0000 1311159.41 1311159.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.38% 3.54 0 8 141174.44 83729 277504 140100.86 0 249636 500310 500310 0.00%
crit 43.62% 2.74 0 7 295760.98 167458 554045 287005.90 0 537280 810849 810849 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5010 2.5% 26.1 11.46s 57714 64164 Direct 27.1 39624 79140 55582 40.4%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.07 27.07 0.00 0.00 0.00 0.8995 0.0000 1504378.43 1504378.43 0.00% 64163.54 64163.54
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.62% 16.14 4 29 39623.64 17450 75137 39634.59 32407 46054 639372 639372 0.00%
crit 40.38% 10.93 1 23 79140.13 34900 158357 79154.15 51407 104636 865006 865006 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.13
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 63736 (86080) 32.2% (43.5%) 115.1 2.59s 223693 225492 Direct 114.9 (152.7) 115032 237526 165967 41.6% (42.1%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.15 114.90 0.00 0.00 0.00 0.9920 0.0000 19070545.14 19070545.14 0.00% 225491.67 225491.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.42% 67.12 39 98 115031.87 75802 221513 115102.98 105254 127513 7721527 7721527 0.00%
crit 41.58% 47.78 22 78 237526.02 151605 443027 237721.68 212605 268710 11349018 11349018 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.12
  • if_expr:variable.starsurge_condition1
    st
    [X]:31.03
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 22344 11.3% 38.0 7.80s 175869 0 Direct 37.8 121011 248367 176701 43.7%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.02 37.84 0.00 0.00 0.00 0.0000 0.0000 6686916.79 6686916.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.27% 21.30 5 42 121011.06 79263 231627 121073.02 100938 148040 2576966 2576966 0.00%
crit 43.73% 16.55 4 34 248367.36 158527 463253 248503.24 202061 339174 4109951 4109951 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10779 5.5% 17.4 18.04s 185740 190479 Direct 17.4 7967 16131 11075 38.1%
Periodic 309.7 7094 14377 9808 37.3% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.39 17.39 309.68 309.68 16.39 0.9751 0.9668 3229763.77 3229763.77 0.00% 10209.95 190479.11
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.93% 10.77 2 19 7966.80 4758 13918 7959.29 6769 10066 85797 85797 0.00%
crit 38.07% 6.62 0 15 16130.67 9515 28683 16128.89 0 21619 106781 106781 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.74% 194.30 132 261 7094.14 86 12477 7093.79 6756 7498 1378358 1378358 0.00%
crit 37.26% 115.38 67 171 14377.06 253 24954 14378.48 13528 15663 1658828 1658828 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.52
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.87
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3218) 0.0% (1.6%) 8.5 32.35s 113509 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1676 0.8% 8.5 32.35s 59124 0 Direct 8.5 46389 92722 59125 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 8.50 0.00 0.00 0.00 0.0000 0.0000 502745.69 502745.69 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.51% 6.17 0 19 46389.06 45138 52393 46348.48 0 52393 286031 286031 0.00%
crit 27.49% 2.34 0 10 92721.82 90276 104786 84428.16 0 104786 216715 216715 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1542 0.8% 16.5 15.70s 28072 0 Direct 16.5 22062 44097 28074 27.3%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 0.00 0.0000 0.0000 462442.12 462442.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.73% 11.98 1 32 22062.32 21478 24931 22062.18 21478 23733 264314 264314 0.00%
crit 27.27% 4.49 0 17 44097.36 42956 49861 43522.56 0 49861 198129 198129 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 19165 9.7% 115.5 2.54s 49693 52312 Direct 115.1 33476 69004 49872 46.1%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.51 115.09 0.00 0.00 0.00 0.9499 0.0000 5739911.39 5739911.39 0.00% 52312.27 52312.27
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.85% 61.98 36 92 33476.32 12962 108953 33478.58 29383 38316 2074788 2074788 0.00%
crit 46.15% 53.11 28 83 69004.24 25924 213427 69018.02 59604 79437 3665124 3665124 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:113.81

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
460 T31_4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 185.01s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.7 68.94s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.66 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.32s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:460 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 308.20s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.46s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.4s 33.8s 8.6s 24.91% 28.79% 1.5 (7.1) 8.5

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 52.0s
  • trigger_min/max:2.7s / 52.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.18% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.04%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.39%
  • balance_of_all_things_arcane_8:3.40%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.42% 54.49% 3.5 (20.2) 17.4

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.1s
  • trigger_min/max:0.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 23.1s
  • uptime_min/max:45.70% / 54.15%

Stack Uptimes

  • balance_of_all_things_nature_1:5.84%
  • balance_of_all_things_nature_2:5.94%
  • balance_of_all_things_nature_3:6.06%
  • balance_of_all_things_nature_4:6.18%
  • balance_of_all_things_nature_5:6.33%
  • balance_of_all_things_nature_6:6.49%
  • balance_of_all_things_nature_7:6.67%
  • balance_of_all_things_nature_8:6.91%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.1 61.7 44.8s 4.2s 20.2s 48.22% 0.00% 34.0 (34.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:0.8s / 43.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.64% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.80%
  • balance_t31_4pc_buff_lunar_2:4.40%
  • balance_t31_4pc_buff_lunar_3:5.14%
  • balance_t31_4pc_buff_lunar_4:5.60%
  • balance_t31_4pc_buff_lunar_5:28.28%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.2 100.9 21.7s 2.6s 19.0s 90.25% 0.00% 46.9 (46.9) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.0s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:87.12% / 93.18%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.86%
  • balance_t31_4pc_buff_solar_2:12.26%
  • balance_t31_4pc_buff_solar_3:16.02%
  • balance_t31_4pc_buff_solar_4:11.53%
  • balance_t31_4pc_buff_solar_5:42.58%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.4s 70.4s 10.8s 10.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 341.9s
  • trigger_min/max:12.0s / 341.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.91%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.91%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.92%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.8s 70.4s 45.8s 33.44% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 359.3s
  • trigger_min/max:12.0s / 341.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 317.6s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.44%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 9.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 339.9s
  • trigger_min/max:12.0s / 339.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 37.22%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.1s 70.4s 45.6s 33.27% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 354.7s
  • trigger_min/max:12.0s / 339.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 323.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.27%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.4s 70.4s 10.8s 10.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 333.2s
  • trigger_min/max:12.0s / 333.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.75%

Stack Uptimes

  • best_friends_with_urctos_1:0.90%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.7s 70.4s 45.5s 33.29% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 354.6s
  • trigger_min/max:12.0s / 333.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.29%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.52% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.52%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.9s 58.3s 50.1s 80.17% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 353.0s
  • trigger_min/max:15.0s / 330.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 359.0s
  • uptime_min/max:44.28% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.17%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.5 0.0 45.0s 32.0s 41.2s 57.21% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 268.7s
  • trigger_min/max:0.0s / 148.6s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 246.5s
  • uptime_min/max:19.47% / 97.46%

Stack Uptimes

  • denizen_of_the_dream_1:38.48%
  • denizen_of_the_dream_2:14.39%
  • denizen_of_the_dream_3:3.56%
  • denizen_of_the_dream_4:0.67%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.01%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.4 20.0s 20.7s 3.1s 16.00% 21.26% 0.4 (0.8) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.1s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.8s
  • uptime_min/max:8.92% / 28.27%

Stack Uptimes

  • dreamstate_1:9.66%
  • dreamstate_2:6.35%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.3s 44.8s 20.6s 49.30% 52.53% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.10% / 56.13%

Stack Uptimes

  • eclipse_lunar_1:49.30%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.1s 92.70% 96.00% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.5s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.36% / 95.08%

Stack Uptimes

  • eclipse_solar_1:92.70%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.9s 306.9s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.2s
  • trigger_min/max:300.0s / 328.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.03%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.6s 32.0s 24.9s 43.42% 43.39% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 217.9s
  • trigger_min/max:0.0s / 148.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 154.0s
  • uptime_min/max:13.19% / 82.34%

Stack Uptimes

  • friend_of_the_fae_1:43.42%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.8s 44.8s 20.2s 48.38% 51.26% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.38%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.7s 99.7s 19.5s 23.26% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.0s
  • trigger_min/max:90.0s / 126.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.30% / 26.42%

Stack Uptimes

  • kindled_soul_5:1.10%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.17%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.39% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.5s
  • trigger_min/max:12.8s / 70.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.65% / 30.54%

Stack Uptimes

  • natures_grace_1:25.39%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.1s
  • trigger_min/max:90.0s / 92.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.54% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.9s 68.7s 7.7s 6.25% 6.94% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.2s / 336.4s
  • trigger_min/max:0.0s / 336.4s
  • trigger_pct:14.98%
  • duration_min/max:0.0s / 28.4s
  • uptime_min/max:0.00% / 27.65%

Stack Uptimes

  • owlkin_frenzy_1:6.25%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 108.0 38.8s 38.8s 34.8s 93.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.5s / 50.6s
  • trigger_min/max:24.5s / 50.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s
  • uptime_min/max:90.26% / 96.65%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.00%
  • primordial_arcanic_pulsar_8:5.53%
  • primordial_arcanic_pulsar_12:6.58%
  • primordial_arcanic_pulsar_16:6.93%
  • primordial_arcanic_pulsar_20:6.46%
  • primordial_arcanic_pulsar_24:6.04%
  • primordial_arcanic_pulsar_28:7.85%
  • primordial_arcanic_pulsar_32:8.02%
  • primordial_arcanic_pulsar_36:6.59%
  • primordial_arcanic_pulsar_40:7.18%
  • primordial_arcanic_pulsar_44:6.99%
  • primordial_arcanic_pulsar_48:7.04%
  • primordial_arcanic_pulsar_52:7.30%
  • primordial_arcanic_pulsar_56:6.47%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.56% 39.80% 4.0 (4.0) 18.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:35.80% / 42.29%

Stack Uptimes

  • solstice_1:39.56%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.7 94.4 14.7s 2.6s 14.1s 97.23% 0.00% 53.3 (53.3) 7.6

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.0s
  • trigger_min/max:0.8s / 10.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.63% / 99.11%

Stack Uptimes

  • starlord_1:9.44%
  • starlord_2:15.39%
  • starlord_3:72.40%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.8s 5.5s 43.1s 90.16% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 35.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.7s
  • uptime_min/max:70.23% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.16%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.0s 45.6s 16.5s 23.62% 0.00% 1.2 (1.2) 4.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 221.3s
  • trigger_min/max:0.0s / 221.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 78.4s
  • uptime_min/max:4.78% / 60.16%

Stack Uptimes

  • wafting_devotion_1:23.62%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.4s 48.4s 21.9s 44.71% 43.77% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.44% / 51.33%

Stack Uptimes

  • warrior_of_elune_1:21.61%
  • warrior_of_elune_2:4.87%
  • warrior_of_elune_3:18.23%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.5 2.0 23.0 32.0s 0.0s 148.6s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.6s 29.1s 52.0s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.42% 0.5s 0.0s 2.6s
Astral Smolder 77.85% 55.48% 92.65% 14.8s 0.0s 112.0s
Incarnation (Total) 48.38% 43.34% 55.00% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.11% 25.69% 30.29% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.14% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.32% 35.51% 50.74% 10.8s 0.0s 15.0s
No Eclipse 6.36% 3.87% 8.65% 1.5s 0.0s 3.7s
Friend of the Fae 43.42% 13.19% 82.34% 24.9s 0.0s 154.0s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.1010.00037.02043.65626.06771.006
Full Moon
New Moon
Half Moon
0.3480.00023.8615.9115.33029.557

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.174.6%56.3849.7%0.000.0%51.9645.8%
Starfire25.0692.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.3240.2%0.000.0%68.8359.8%
New Moon0.040.7%0.193.1%0.000.0%5.7796.2%
Half Moon0.000.1%0.335.8%0.000.0%5.3494.1%
Full Moon0.211.8%3.1527.2%0.080.7%8.1570.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
460 T31_4p
Nature's BalanceAstral Power99.46198.825.48%2.000.110.05%
Full MoonAstral Power5.29264.107.28%49.950.280.11%
Half MoonAstral Power5.68136.213.75%24.000.000.00%
MoonfireAstral Power14.3485.952.37%6.000.070.08%
New MoonAstral Power6.0072.041.98%12.000.000.00%
Orbit BreakerAstral Power6.31188.095.18%29.831.060.56%
Shooting Stars (Moonfire)Astral Power94.43188.665.20%2.000.200.11%
Shooting Stars (Sunfire)Astral Power94.68189.165.21%2.000.200.10%
StarfireAstral Power27.07397.3510.95%14.682.790.70%
SunfireAstral Power17.39104.322.87%6.000.010.01%
WrathAstral Power115.511805.1449.73%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
460 T31_4p
StarsurgeAstral Power 115.313640.92100.00%31.5731.627074.43
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 708220.0 3234.03 3811.32 1488654.8 535094.3 -421537.7 708220.0
Astral Power 70.0 12.10 12.12 4.7 24.2 0.0 100.0

Statistics & Data Analysis

Fight Length
460 T31_4p Fight Length
Count 21975
Mean 299.90
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6164
5th Percentile 245.98
95th Percentile 354.08
( 95th Percentile - 5th Percentile ) 108.10
Mean Distribution
Standard Deviation 0.2335
95.00% Confidence Interval ( 299.44 - 300.35 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51182
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1023
DPS
460 T31_4p Damage Per Second
Count 21975
Mean 197642.46
Minimum 171644.36
Maximum 234106.82
Spread ( max - min ) 62462.46
Range [ ( max - min ) / 2 * 100% ] 15.80%
Standard Deviation 7467.4136
5th Percentile 185922.23
95th Percentile 210346.16
( 95th Percentile - 5th Percentile ) 24423.94
Mean Distribution
Standard Deviation 50.3739
95.00% Confidence Interval ( 197543.73 - 197741.19 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5484
0.1 Scale Factor Error with Delta=300 476019
0.05 Scale Factor Error with Delta=300 1904076
0.01 Scale Factor Error with Delta=300 47601878
Priority Target DPS
460 T31_4p Priority Target Damage Per Second
Count 21975
Mean 197642.46
Minimum 171644.36
Maximum 234106.82
Spread ( max - min ) 62462.46
Range [ ( max - min ) / 2 * 100% ] 15.80%
Standard Deviation 7467.4136
5th Percentile 185922.23
95th Percentile 210346.16
( 95th Percentile - 5th Percentile ) 24423.94
Mean Distribution
Standard Deviation 50.3739
95.00% Confidence Interval ( 197543.73 - 197741.19 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5484
0.1 Scale Factor Error with Delta=300 476019
0.05 Scale Factor Error with Delta=300 1904076
0.01 Scale Factor Error with Delta=300 47601878
DPS(e)
460 T31_4p Damage Per Second (Effective)
Count 21975
Mean 197642.46
Minimum 171644.36
Maximum 234106.82
Spread ( max - min ) 62462.46
Range [ ( max - min ) / 2 * 100% ] 15.80%
Damage
460 T31_4p Damage
Count 21975
Mean 57282450.98
Minimum 41822123.06
Maximum 73007471.49
Spread ( max - min ) 31185348.43
Range [ ( max - min ) / 2 * 100% ] 27.22%
DTPS
460 T31_4p Damage Taken Per Second
Count 21975
Mean 3811.61
Minimum 887.28
Maximum 7718.06
Spread ( max - min ) 6830.78
Range [ ( max - min ) / 2 * 100% ] 89.60%
HPS
460 T31_4p Healing Per Second
Count 21975
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
460 T31_4p Healing Per Second (Effective)
Count 21975
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
460 T31_4p Heal
Count 21975
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
460 T31_4p Healing Taken Per Second
Count 21975
Mean 3225.54
Minimum 651.91
Maximum 6802.01
Spread ( max - min ) 6150.10
Range [ ( max - min ) / 2 * 100% ] 95.33%
TMI
460 T31_4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
460 T31_4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
460 T31_4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.52 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.26 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.13 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.12 starsurge,if=variable.starsurge_condition1
R 15.87 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.14 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 31.03 starsurge,if=variable.starsurge_condition2
Y 113.81 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYYXRYXWQQSYQYYYXYXYTOXYYXYWQQRQYQYYYYYXSYXXYWQPPQYQRYYYYXYYWQPPQQSYQRUXYOYWQQQVXPPQYQSYRYYQFQYYQYPPQYQYYYRQQSYYPPQEQTQUXOYYQRQYYQPPQQSYYYWQQYYQYRYPPQYYWQQSYQVQQTQRYYWQYOPPQQYQYQSYYYRQQYPFPQYNQUQVYXYWQQRQSYQYYXYXYYEWQQTQYYYYRXYSXYWQOQYQYYXYPPQQURYYWQQQYYSYPPQQYYYYWQQRYQYYYPPQSYWQQYYQORYYXYFXVWQQQTYYYXSXPPRXUWQQYY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 460 T31_4p 50.0/100: 50% astral_power
Pre precombat 1 food 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 460 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 460 T31_4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.940 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.879 st L starfire Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.725 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.725 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.725 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.725 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.581 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.402 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.191 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.944 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.706 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.721 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.484 st V full_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:10.005 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.760 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.522 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.278 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.040 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.802 st R sunfire Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.564 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.327 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.091 st W cancel_buff Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.091 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.944 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.764 st S moonfire Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:18.554 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.344 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.135 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.897 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.660 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.424 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.186 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.950 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.712 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.474 st T new_moon Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.451 st O warrior_of_elune Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.451 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.215 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.978 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.740 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.502 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.264 st W cancel_buff Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.264 st Q starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.118 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.940 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.731 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:33.522 st Y wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:34.284 st Q starsurge Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:35.046 st Y wrath Fluffy_Pillow 0.0/100: 0% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:35.810 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:36.573 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:37.336 st Y wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:38.099 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:38.861 st X starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:39.623 st S moonfire Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:40.386 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:41.377 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:42.366 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:43.358 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.349 st W cancel_buff Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.349 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:45.458 st P starfire Fluffy_Pillow 22.0/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, undulating_sporecloak, corrupting_rage
0:46.213 st P starfire Fluffy_Pillow 38.8/100: 39% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:46.966 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:48.033 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:49.059 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:50.088 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:51.079 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:52.170 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:53.259 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:54.350 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:55.439 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:56.527 st Y wrath Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:57.616 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:58.706 st W cancel_buff Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:58.706 st Q starsurge Fluffy_Pillow 85.6/100: 86% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:59.927 st P starfire Fluffy_Pillow 49.6/100: 50% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:01.685 st P starfire Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:02.644 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:03.710 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(2), balance_t31_4pc_buff_solar, dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:04.738 st S moonfire Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:05.728 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:06.484 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:07.475 st R sunfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:08.466 st U half_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:09.786 st X starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:10.775 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:11.766 st O warrior_of_elune Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:11.766 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:12.756 st W cancel_buff Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:12.756 st Q starsurge Fluffy_Pillow 83.6/100: 84% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_pip_static, corrupting_rage
1:13.865 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_pip_static, corrupting_rage
1:14.931 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_pip_static, corrupting_rage
1:15.958 st V full_moon Fluffy_Pillow 5.6/100: 6% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:17.934 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:18.925 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power denizen_of_the_dream, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:19.680 st P starfire Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:20.434 st Q starsurge Fluffy_Pillow 65.2/100: 65% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:21.425 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:22.415 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:23.404 st S moonfire Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:24.393 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:25.383 st R sunfire Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:26.472 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:27.563 st Y wrath Fluffy_Pillow 73.2/100: 73% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:28.651 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:29.871 default F natures_vigil 460 T31_4p 53.2/100: 53% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:30.000 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:31.174 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:32.303 st Y wrath Fluffy_Pillow 35.2/100: 35% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:33.432 st Q starsurge Fluffy_Pillow 53.2/100: 53% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
1:34.562 st Y wrath Fluffy_Pillow 17.2/100: 17% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak
1:35.651 st P starfire Fluffy_Pillow 27.2/100: 27% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_urctos_static
1:36.406 st P starfire Fluffy_Pillow 46.0/100: 46% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, best_friends_with_urctos_static
1:37.162 st Q starsurge Fluffy_Pillow 62.8/100: 63% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos_static
1:38.152 st Y wrath Fluffy_Pillow 28.8/100: 29% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:39.142 st Q starsurge Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static
1:40.131 st Y wrath Fluffy_Pillow 12.8/100: 13% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:41.122 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:42.212 st Y wrath Fluffy_Pillow 48.8/100: 49% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:43.303 st R sunfire Fluffy_Pillow 64.8/100: 65% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:44.394 st Q starsurge Fluffy_Pillow 70.8/100: 71% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
1:45.613 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
1:46.785 st S moonfire Fluffy_Pillow 6.8/100: 7% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
1:47.914 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
1:49.044 st Y wrath Fluffy_Pillow 32.8/100: 33% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:50.171 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:51.735 st P starfire Fluffy_Pillow 62.8/100: 63% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:52.590 st Q starsurge Fluffy_Pillow 74.8/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:53.540 default E use_items Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
1:53.540 st Q starsurge Fluffy_Pillow 42.8/100: 43% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:54.375 st T new_moon Fluffy_Pillow 20.8/100: 21% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
1:55.127 st Q starsurge Fluffy_Pillow 36.8/100: 37% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
1:55.960 st U half_moon Fluffy_Pillow 10.8/100: 11% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
1:57.070 st X starsurge Fluffy_Pillow 40.8/100: 41% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
1:57.903 st O warrior_of_elune Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
1:57.903 st Y wrath Fluffy_Pillow 14.8/100: 15% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
1:58.657 st Y wrath Fluffy_Pillow 30.8/100: 31% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
1:59.574 st Q starsurge Fluffy_Pillow 46.8/100: 47% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
2:00.600 st R sunfire Fluffy_Pillow 20.8/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
2:01.585 st Q starsurge Fluffy_Pillow 28.8/100: 29% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
2:02.572 st Y wrath Fluffy_Pillow 0.8/100: 1% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
2:03.522 st Y wrath Fluffy_Pillow 18.8/100: 19% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
2:04.472 st Q starsurge Fluffy_Pillow 34.8/100: 35% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
2:05.421 st P starfire Fluffy_Pillow 6.8/100: 7% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(45)
2:06.173 st P starfire Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage, kindled_soul(40)
2:06.927 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip(11), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(35)
2:07.841 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_pip(10), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(30)
2:08.755 st S moonfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(9), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(25)
2:09.672 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(8), best_friends_with_pip_static, wafting_devotion, corrupting_rage, kindled_soul(20)
2:10.587 st Y wrath Fluffy_Pillow 42.4/100: 42% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
2:11.577 st Y wrath Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
2:12.666 st W cancel_buff Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:12.666 st Q starsurge Fluffy_Pillow 80.4/100: 80% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
2:13.884 st Q starsurge Fluffy_Pillow 44.4/100: 44% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:15.056 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:16.185 st Y wrath Fluffy_Pillow 28.4/100: 28% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:17.315 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:18.444 st Y wrath Fluffy_Pillow 14.4/100: 14% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:19.533 st R sunfire Fluffy_Pillow 34.4/100: 34% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
2:20.623 st Y wrath Fluffy_Pillow 40.4/100: 40% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_pip_static, undulating_sporecloak
2:21.715 st P starfire Fluffy_Pillow 52.4/100: 52% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:22.470 st P starfire Fluffy_Pillow 71.2/100: 71% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:23.362 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:24.350 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:25.340 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:26.329 st W cancel_buff Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:26.329 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak
2:27.439 st Q starsurge Fluffy_Pillow 57.2/100: 57% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_pip_static, undulating_sporecloak
2:28.612 st S moonfire Fluffy_Pillow 21.2/100: 21% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
2:29.741 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_pip_static, undulating_sporecloak
2:30.869 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:31.998 st V full_moon Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak
2:33.974 st Q starsurge Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar, best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak
2:34.963 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:35.952 st T new_moon Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
2:36.708 st Q starsurge Fluffy_Pillow 35.2/100: 35% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:37.696 st R sunfire Fluffy_Pillow 7.2/100: 7% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
2:38.685 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
2:39.674 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:40.667 st W cancel_buff Fluffy_Pillow 47.2/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:40.667 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:41.778 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:42.845 st O warrior_of_elune Fluffy_Pillow 37.2/100: 37% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:42.903 st P starfire Fluffy_Pillow 37.2/100: 37% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:43.657 st P starfire Fluffy_Pillow 54.0/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:44.411 st Q starsurge Fluffy_Pillow 100.0/100: 100% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord, warrior_of_elune, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:45.478 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:46.508 st Y wrath Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:47.501 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:48.492 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:49.483 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:50.574 st S moonfire Fluffy_Pillow 2.0/100: 2% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
2:51.664 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
2:52.751 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
2:53.841 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, corrupting_rage
2:54.931 st R sunfire Fluffy_Pillow 66.0/100: 66% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, corrupting_rage
2:56.021 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:57.241 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:58.412 st Y wrath Fluffy_Pillow 2.0/100: 2% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:59.544 st P starfire Fluffy_Pillow 12.0/100: 12% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.299 default F natures_vigil 460 T31_4p 30.8/100: 31% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, best_friends_with_urctos_static, corrupting_rage
3:00.299 st P starfire Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static, corrupting_rage
3:01.053 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_urctos_static, corrupting_rage
3:02.079 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
3:03.071 st N incarnation_chosen_of_elune Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, corrupting_rage
3:03.071 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate(2), best_friends_with_urctos_static, corrupting_rage
3:03.972 st U half_moon Fluffy_Pillow 7.6/100: 8% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, corrupting_rage
3:05.170 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), best_friends_with_urctos_static, corrupting_rage
3:06.161 st V full_moon Fluffy_Pillow 13.6/100: 14% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), best_friends_with_urctos_static, corrupting_rage
3:08.138 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:08.890 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_urctos_static, corrupting_rage
3:09.881 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, corrupting_rage
3:10.634 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:10.634 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:11.743 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:12.729 st R sunfire Fluffy_Pillow 27.6/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:13.679 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:14.628 st S moonfire Fluffy_Pillow 11.6/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:15.545 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:16.462 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:17.379 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:18.292 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:19.208 st X starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.123 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:21.040 st X starsurge Fluffy_Pillow 41.6/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:21.956 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:22.870 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:23.787 default E use_items Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:23.787 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:23.787 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:24.813 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
3:25.799 st T new_moon Fluffy_Pillow 23.6/100: 24% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
3:26.553 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:27.580 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:28.573 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:29.565 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:30.554 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:31.544 st R sunfire Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:32.532 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
3:33.523 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:34.514 st S moonfire Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:35.505 st X starsurge Fluffy_Pillow 85.6/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:36.495 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:37.487 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:37.487 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:38.597 st O warrior_of_elune Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:38.597 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:39.665 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:40.615 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:41.564 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:42.481 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(10)
3:43.396 st X starsurge Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(5)
3:44.311 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:45.226 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:45.980 st P starfire Fluffy_Pillow 54.4/100: 54% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:46.735 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:47.651 st Q starsurge Fluffy_Pillow 41.2/100: 41% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:48.485 st U half_moon Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:49.593 st R sunfire Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:50.425 st Y wrath Fluffy_Pillow 49.2/100: 49% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:51.259 st Y wrath Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.174 st W cancel_buff Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.174 st Q starsurge Fluffy_Pillow 85.2/100: 85% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.200 st Q starsurge Fluffy_Pillow 59.2/100: 59% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.187 st Q starsurge Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.137 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:56.128 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:57.117 st S moonfire Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:58.110 st Y wrath Fluffy_Pillow 45.2/100: 45% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, undulating_sporecloak
3:59.101 st P starfire Fluffy_Pillow 57.2/100: 57% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:59.854 st P starfire Fluffy_Pillow 74.0/100: 74% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:00.746 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
4:01.738 st Q starsurge Fluffy_Pillow 54.0/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak
4:02.727 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:03.717 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:04.707 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:05.697 st Y wrath Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:06.785 st W cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:06.785 st Q starsurge Fluffy_Pillow 94.0/100: 94% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(24), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak
4:08.005 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(28), starlord, balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak
4:09.176 st R sunfire Fluffy_Pillow 24.0/100: 24% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
4:10.306 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak
4:11.436 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:12.565 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:13.657 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:14.746 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:15.836 st P starfire Fluffy_Pillow 58.0/100: 58% astral_power natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:16.590 st P starfire Fluffy_Pillow 70.0/100: 70% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:17.482 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:18.472 st S moonfire Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:19.461 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:20.451 st W cancel_buff Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:20.451 st Q starsurge Fluffy_Pillow 74.0/100: 74% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:21.561 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:22.631 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:23.762 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:24.805 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.849 st O warrior_of_elune Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:25.849 st R sunfire Fluffy_Pillow 10.0/100: 10% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:26.856 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:27.863 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:28.869 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:29.877 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:30.884 default F natures_vigil 460 T31_4p 64.0/100: 64% astral_power eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:30.884 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:31.892 st V full_moon Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:33.720 st W cancel_buff Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:33.720 st Q starsurge Fluffy_Pillow 88.0/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:34.746 st Q starsurge Fluffy_Pillow 62.0/100: 62% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos_static, wafting_devotion, corrupting_rage
4:35.734 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.683 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.440 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:38.356 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak
4:39.348 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak
4:40.339 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak
4:41.329 st S moonfire Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak
4:42.319 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak
4:43.310 st P starfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak
4:44.065 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:44.819 st R sunfire Fluffy_Pillow 69.6/100: 70% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak
4:45.809 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static
4:46.799 st U half_moon Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static
4:48.118 st W cancel_buff Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static
4:48.118 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static
4:49.228 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static
4:50.400 st Y wrath Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
4:51.529 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), starlord(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 35411 33725 30015
Intellect 2089 0 13505 12693 10000 (6103)
Spirit 0 0 0 0 0
Health 708220 674500 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13505 12693 0
Crit 27.22% 21.01% 2881
Haste 23.40% 23.40% 3770
Versatility 8.77% 3.77% 773
Mana Regen 2560 2560 0
Attack Power 14045 13201 0
Mastery 27.72% 27.72% 7041
Armor 4485 4485 4485
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 468.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 460, stats: { 499 Armor, +2103 Sta, +206 Haste, +487 Vers, +537 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 460, stats: { 727 Armor, +2804 Sta, +639 Crit, +284 Mastery, +716 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 460, stats: { 636 Armor, +2804 Sta, +630 Haste, +293 Mastery, +716 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 460, stats: { 409 Armor, +2103 Sta, +317 Haste, +376 Mastery, +537 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="460 T31_4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=460
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=460,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=460
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=460,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=467.50
# gear_stamina=30015
# gear_intellect=10000
# gear_crit_rating=2881
# gear_haste_rating=3770
# gear_mastery_rating=7041
# gear_versatility_rating=773
# gear_armor=4485
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

470 T31_2p : 185723 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
185723.0 185723.0 92.7 / 0.050% 26261.7 / 14.1% 14811.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.2 12.1 Astral Power 0.00% 66.7 99.9% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31_2p 185723
Astral Smolder 12484 6.7% 64.4 4.62s 58024 0 Periodic 116.6 32038 0 32038 0.0% 77.8%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.40 0.00 116.62 116.62 48.76 0.0000 2.0000 3736501.75 3736501.75 0.00% 16019.44 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.62 74 161 32038.48 8124 109509 32050.73 23873 43155 3736502 3736502 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (5515) 0.0% (3.0%) 8.6 31.92s 193063 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.56 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 9513 3.0% 150.6 1.73s 10969 8478 Direct 149.7 8664 17302 11037 27.5%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 150.64 149.70 0.00 0.00 0.00 1.2938 0.0000 1652262.55 1652262.55 0.00% 8477.71 8477.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.53% 108.58 23 303 8664.24 5618 14899 8655.42 7593 10438 940777 940777 0.00%
crit 27.47% 41.12 4 118 17301.66 11496 29797 17289.59 15008 21322 711485 711485 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.022
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:16098.56
Hungering Shadowflame 3052 1.6% 17.2 16.71s 53104 0 Direct 17.2 41578 83407 53109 27.6%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 0.00 0.00 0.00 0.0000 0.0000 915196.53 915196.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.43% 12.48 2 29 41578.26 27654 160477 41413.62 27839 95082 519000 519000 0.00%
crit 27.57% 4.75 0 15 83407.18 55309 320954 82671.06 0 320954 396196 396196 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2905 1.6% 34.1 8.67s 25549 0 Direct 34.0 20097 40167 25620 27.5%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.06 33.96 0.00 0.00 0.00 0.0000 0.0000 870118.20 870118.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.48% 24.62 7 46 20097.32 19574 22717 20096.92 19771 20855 494713 494713 0.00%
crit 27.52% 9.35 0 24 40167.26 39147 45434 40166.47 0 45434 375406 375406 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 10580 5.7% 14.3 21.60s 221035 227708 Direct 14.3 7862 16005 10664 34.4%
Periodic 309.3 7086 14673 9746 35.1% 99.5%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 309.30 309.30 13.33 0.9708 0.9645 3167420.51 3167420.51 0.00% 10144.58 227708.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.59% 9.40 2 17 7861.84 5782 14045 7857.73 6592 9867 73890 73890 0.00%
crit 34.41% 4.93 0 12 16005.08 11765 28091 15951.53 0 24841 78931 78931 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 64.94% 200.85 129 272 7086.32 291 12821 7088.19 6716 7533 1423264 1423264 0.00%
crit 35.06% 108.45 68 156 14672.96 2861 25642 14678.71 13583 15903 1591336 1591336 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.08
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (17223) 0.0% (9.3%) 17.0 17.94s 303969 254571

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.97 0.00 0.00 0.00 0.00 1.1941 0.0000 0.00 0.00 0.00% 254570.94 254570.94

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 6231 3.4% 5.3 63.09s 353681 190892 Direct 5.3 245242 484548 356001 46.3%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.29 5.26 0.00 0.00 0.00 1.8528 0.0000 1871883.43 1871883.43 0.00% 190891.64 190891.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.72% 2.82 0 6 245241.60 164297 405876 240208.16 0 386415 692808 692808 0.00%
crit 46.28% 2.43 0 6 484548.14 328595 809877 463099.49 0 759550 1179076 1179076 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.35
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 4670 2.5% 6.0 53.50s 232491 308157 Direct 6.0 152600 321663 233967 48.1%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.00 5.97 0.00 0.00 0.00 0.7545 0.0000 1395644.51 1395644.51 0.00% 308157.32 308157.32
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.87% 3.09 0 7 152600.16 85750 238330 150209.46 0 235051 472223 472223 0.00%
crit 48.13% 2.87 0 7 321662.67 168523 476661 317370.75 0 470103 923421 923421 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.02
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6321 3.4% 5.7 57.84s 333211 272686 Direct 5.6 217792 434742 334918 54.0%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2221 0.0000 1891352.12 1891352.12 0.00% 272686.29 272686.29
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 46.01% 2.60 0 7 217791.59 120475 347751 210704.71 0 333524 565812 565812 0.00%
crit 53.99% 3.05 0 7 434741.62 242252 695502 428028.50 0 666441 1325540 1325540 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.70
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (16295) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6091 3.3% 94.7 3.14s 19279 0 Direct 94.4 13113 27287 19331 43.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.66 94.40 0.00 0.00 0.00 0.0000 0.0000 1824860.98 1824860.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.13% 52.98 23 91 13112.81 8489 25162 13113.27 11749 14628 694782 694782 0.00%
crit 43.87% 41.41 15 70 27287.22 16978 50324 27294.36 24245 31491 1130079 1130079 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6094 3.3% 94.9 3.15s 19245 0 Direct 94.6 13100 27252 19297 43.8%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.87 94.61 0.00 0.00 0.00 0.0000 0.0000 1825804.46 1825804.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.21% 53.18 22 90 13100.26 8489 25162 13100.57 11817 14768 696673 696673 0.00%
crit 43.79% 41.43 18 72 27252.23 16978 50324 27258.03 24421 31012 1129131 1129131 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4110 2.2% 6.3 47.94s 194984 0 Direct 6.3 132419 276020 195637 44.0%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.32 6.29 0.00 0.00 0.00 0.0000 0.0000 1231364.78 1231364.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.98% 3.52 0 8 132419.21 85720 247121 131328.58 0 236311 466575 466575 0.00%
crit 44.02% 2.77 0 9 276020.28 171441 493872 267976.06 0 481346 764789 764789 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5121 2.8% 26.1 11.47s 58996 65631 Direct 27.1 40487 80819 56816 40.5%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.06 27.06 0.00 0.00 0.00 0.8989 0.0000 1537209.92 1537209.92 0.00% 65631.03 65631.03
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.52% 16.10 4 31 40487.30 17841 74973 40495.75 32891 46958 651938 651938 0.00%
crit 40.48% 10.95 1 22 80818.74 35681 151502 80810.79 52540 111062 885272 885272 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.12
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 59518 (80424) 32.0% (43.3%) 115.4 2.58s 208583 210754 Direct 115.1 (153.0) 106950 221240 154702 41.8% (42.3%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.37 115.12 0.00 0.00 0.00 0.9897 0.0000 17808808.23 17808808.23 0.00% 210754.31 210754.31
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.22% 67.02 39 98 106950.49 75634 200021 106967.04 99205 116630 7168155 7168155 0.00%
crit 41.78% 48.10 23 73 221240.10 148683 400043 221357.10 200246 256833 10640653 10640653 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.13
  • if_expr:variable.starsurge_condition1
    st
    [X]:31.23
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 20906 11.2% 38.1 7.77s 164208 0 Direct 37.9 112533 232134 165011 43.9%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.09 37.90 0.00 0.00 0.00 0.0000 0.0000 6254486.12 6254486.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.12% 21.27 5 43 112532.55 77736 209154 112551.93 98190 136629 2393926 2393926 0.00%
crit 43.88% 16.63 3 39 232133.56 162297 418307 232229.09 193681 286637 3860560 3860560 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 10421 5.6% 17.4 18.04s 179588 184591 Direct 17.4 7701 15576 10713 38.3%
Periodic 310.3 6837 13847 9461 37.4% 99.8%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.38 17.38 310.26 310.26 16.38 0.9729 0.9645 3121797.08 3121797.08 0.00% 9873.92 184590.65
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.75% 10.73 3 20 7700.69 4862 13397 7692.57 6512 9044 82657 82657 0.00%
crit 38.25% 6.65 0 16 15576.15 9724 26519 15563.10 0 20589 103575 103575 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.56% 194.10 130 257 6836.54 398 11655 6835.31 6500 7237 1326943 1326943 0.00%
crit 37.44% 116.17 68 168 13847.23 1742 23311 13847.38 13047 14773 1608622 1608622 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.50
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.88
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3224) 0.0% (1.7%) 8.5 31.80s 113734 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1678 0.9% 8.5 31.80s 59187 0 Direct 8.5 46426 92779 59188 27.5%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.50 8.50 0.00 0.00 0.00 0.0000 0.0000 502866.66 502866.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.47% 6.16 0 17 46425.63 45178 52434 46393.05 0 51895 285846 285846 0.00%
crit 27.53% 2.34 0 10 92778.89 90357 104867 84825.04 0 104867 217021 217021 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1546 0.8% 16.5 15.45s 28144 0 Direct 16.5 22078 44124 28144 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 0.00 0.0000 0.0000 463442.05 463442.05 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.49% 11.94 1 35 22078.19 21497 24950 22076.94 21497 23924 263532 263532 0.00%
crit 27.51% 4.53 0 17 44123.89 42995 49900 43526.71 0 49900 199910 199910 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 18480 10.0% 115.9 2.53s 47762 50382 Direct 115.4 32174 66214 47934 46.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.85 115.43 0.00 0.00 0.00 0.9480 0.0000 5533326.74 5533326.74 0.00% 50382.21 50382.21
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.70% 61.99 33 96 32174.23 13246 102726 32172.78 28459 36590 1994439 1994439 0.00%
crit 46.30% 53.45 27 83 66214.24 26492 201297 66219.85 56638 76988 3538888 3538888 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:114.15

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31_2p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 185.38s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.6 67.15s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.34s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_2p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.94s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.47 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.47s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.12 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.12
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.4s 33.8s 8.6s 24.93% 28.80% 1.5 (7.1) 8.5

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.8s
  • trigger_min/max:2.7s / 50.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.05% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:3.00%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.04%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.40%
  • balance_of_all_things_arcane_8:3.41%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.0 3.5 17.0s 14.1s 8.4s 50.48% 54.56% 3.5 (19.9) 17.5

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.6s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.4s
  • uptime_min/max:45.75% / 54.51%

Stack Uptimes

  • balance_of_all_things_nature_1:5.85%
  • balance_of_all_things_nature_2:5.95%
  • balance_of_all_things_nature_3:6.07%
  • balance_of_all_things_nature_4:6.19%
  • balance_of_all_things_nature_5:6.34%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Best Friends with Aerwynn 2.8 0.0 70.1s 70.1s 10.8s 10.05% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 340.4s
  • trigger_min/max:12.0s / 340.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.21%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.90%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.91%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.92%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.6s 70.1s 45.7s 33.43% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 352.2s
  • trigger_min/max:12.0s / 340.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 316.3s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.43%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.4s 70.4s 10.8s 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 333.5s
  • trigger_min/max:12.0s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.44%

Stack Uptimes

  • best_friends_with_pip_1:0.90%
  • best_friends_with_pip_2:0.90%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.91%
  • best_friends_with_pip_5:0.91%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.92%
  • best_friends_with_pip_8:0.92%
  • best_friends_with_pip_9:0.92%
  • best_friends_with_pip_10:0.93%
  • best_friends_with_pip_11:0.93%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.0s 70.4s 45.5s 33.35% 0.00% 69.5 (69.5) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 345.7s
  • trigger_min/max:12.0s / 333.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.8s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.35%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.6s 70.6s 10.8s 10.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 351.9s
  • trigger_min/max:12.0s / 351.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 34.54%

Stack Uptimes

  • best_friends_with_urctos_1:0.89%
  • best_friends_with_urctos_2:0.90%
  • best_friends_with_urctos_3:0.90%
  • best_friends_with_urctos_4:0.90%
  • best_friends_with_urctos_5:0.91%
  • best_friends_with_urctos_6:0.91%
  • best_friends_with_urctos_7:0.91%
  • best_friends_with_urctos_8:0.92%
  • best_friends_with_urctos_9:0.92%
  • best_friends_with_urctos_10:0.92%
  • best_friends_with_urctos_11:0.93%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 114.0s 70.6s 45.5s 33.22% 0.00% 69.2 (69.2) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 354.0s
  • trigger_min/max:12.0s / 351.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 315.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.22%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.53% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.53%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 61.7s 58.1s 49.8s 80.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 341.0s
  • trigger_min/max:15.0s / 308.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.7s
  • uptime_min/max:44.47% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.06%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 45.2s 31.8s 41.3s 57.33% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 316.6s
  • trigger_min/max:0.0s / 153.5s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 319.2s
  • uptime_min/max:21.04% / 96.78%

Stack Uptimes

  • denizen_of_the_dream_1:38.47%
  • denizen_of_the_dream_2:14.46%
  • denizen_of_the_dream_3:3.63%
  • denizen_of_the_dream_4:0.67%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.5 20.1s 20.6s 3.1s 15.82% 21.18% 0.5 (0.8) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.5s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:8.69% / 26.75%

Stack Uptimes

  • dreamstate_1:9.57%
  • dreamstate_2:6.25%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.2s 44.7s 20.6s 49.35% 52.52% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.09% / 56.13%

Stack Uptimes

  • eclipse_lunar_1:49.35%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.1s 92.79% 96.04% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.7s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 69.0s
  • uptime_min/max:90.45% / 95.07%

Stack Uptimes

  • eclipse_solar_1:92.79%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 306.9s 306.9s 27.4s 13.18% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.4s
  • trigger_min/max:300.0s / 328.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.89% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.18%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.6s 31.8s 25.0s 43.52% 43.48% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 206.5s
  • trigger_min/max:0.0s / 153.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 132.7s
  • uptime_min/max:14.03% / 81.48%

Stack Uptimes

  • friend_of_the_fae_1:43.52%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.7s 44.7s 20.2s 48.43% 51.26% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 90.3s
  • trigger_min/max:12.0s / 90.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.43%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.6s 99.6s 19.5s 23.27% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 125.0s
  • trigger_min/max:90.0s / 125.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.32% / 26.26%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.42% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.3s
  • trigger_min/max:12.8s / 70.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.47% / 30.78%

Stack Uptimes

  • natures_grace_1:25.42%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.42% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.51% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.42%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.7s 68.7s 7.7s 6.28% 6.98% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.3s / 335.7s
  • trigger_min/max:0.0s / 335.7s
  • trigger_pct:14.96%
  • duration_min/max:0.0s / 34.4s
  • uptime_min/max:0.00% / 26.52%

Stack Uptimes

  • owlkin_frenzy_1:6.28%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 108.2 38.7s 38.7s 34.7s 94.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.2s / 50.5s
  • trigger_min/max:24.2s / 50.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.9s
  • uptime_min/max:90.24% / 96.73%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.01%
  • primordial_arcanic_pulsar_8:5.51%
  • primordial_arcanic_pulsar_12:6.58%
  • primordial_arcanic_pulsar_16:6.89%
  • primordial_arcanic_pulsar_20:6.49%
  • primordial_arcanic_pulsar_24:6.04%
  • primordial_arcanic_pulsar_28:7.71%
  • primordial_arcanic_pulsar_32:8.05%
  • primordial_arcanic_pulsar_36:6.62%
  • primordial_arcanic_pulsar_40:7.22%
  • primordial_arcanic_pulsar_44:7.03%
  • primordial_arcanic_pulsar_48:7.00%
  • primordial_arcanic_pulsar_52:7.34%
  • primordial_arcanic_pulsar_56:6.50%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.60% 39.84% 4.0 (4.0) 18.1

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.6s
  • trigger_min/max:0.0s / 40.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 18.0s
  • uptime_min/max:36.03% / 42.47%

Stack Uptimes

  • solstice_1:39.60%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.7 94.6 14.7s 2.6s 14.1s 97.27% 0.00% 53.5 (53.5) 7.6

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 20.9s
  • trigger_min/max:0.8s / 11.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.91% / 99.20%

Stack Uptimes

  • starlord_1:9.39%
  • starlord_2:15.32%
  • starlord_3:72.56%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 48.0s 5.5s 43.2s 90.18% 0.00% 54.4 (54.4) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 320.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 353.7s
  • uptime_min/max:72.63% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.18%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 60.8s 45.3s 16.5s 23.71% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 231.8s
  • trigger_min/max:0.0s / 212.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 75.2s
  • uptime_min/max:4.86% / 60.74%

Stack Uptimes

  • wafting_devotion_1:23.71%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.5s 48.5s 21.9s 44.59% 43.66% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:31.89% / 50.92%

Stack Uptimes

  • warrior_of_elune_1:21.42%
  • warrior_of_elune_2:4.88%
  • warrior_of_elune_3:18.29%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 24.0 31.8s 0.0s 153.5s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.5s 28.8s 50.8s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.84% 0.5s 0.0s 2.7s
Astral Smolder 78.03% 55.25% 92.18% 15.0s 0.0s 122.0s
Incarnation (Total) 48.43% 43.34% 55.00% 20.2s 0.0s 54.0s
Incarnation (Pulsar) 28.16% 25.79% 30.60% 11.7s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.13% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.36% 35.91% 50.64% 10.8s 0.0s 15.0s
No Eclipse 6.27% 3.96% 8.64% 1.5s 0.0s 3.7s
Friend of the Fae 43.52% 14.03% 81.48% 25.0s 0.0s 132.7s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.1630.00036.95943.98125.96371.256
Full Moon
New Moon
Half Moon
0.3470.00023.3185.8835.34328.996

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.164.5%56.6349.7%0.000.0%52.0645.7%
Starfire25.0592.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.4040.2%0.000.0%68.9659.8%
New Moon0.040.7%0.203.4%0.000.0%5.7695.9%
Half Moon0.000.0%0.345.9%0.000.0%5.3494.0%
Full Moon0.221.9%3.1427.1%0.080.6%8.1770.4%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31_2p
Nature's BalanceAstral Power99.42198.745.47%2.000.110.05%
Full MoonAstral Power5.29264.287.27%49.940.330.12%
Half MoonAstral Power5.68136.243.75%24.000.000.00%
MoonfireAstral Power14.3385.922.36%6.000.060.07%
New MoonAstral Power6.0072.041.98%12.000.000.00%
Orbit BreakerAstral Power6.32188.415.18%29.831.050.55%
Shooting Stars (Moonfire)Astral Power94.66189.115.20%2.000.200.11%
Shooting Stars (Sunfire)Astral Power94.87189.545.21%2.000.200.10%
StarfireAstral Power27.06397.2710.92%14.682.790.70%
SunfireAstral Power17.38104.292.87%6.000.010.01%
WrathAstral Power115.851810.6949.79%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31_2p
StarsurgeAstral Power 115.553648.40100.00%31.5731.626595.57
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 734600.0 3285.79 3903.42 1347408.4 549453.0 -431976.9 734600.0
Astral Power 70.0 12.13 12.15 4.7 24.0 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31_2p Fight Length
Count 19721
Mean 299.77
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 34.5892
5th Percentile 246.10
95th Percentile 354.24
( 95th Percentile - 5th Percentile ) 108.14
Mean Distribution
Standard Deviation 0.2463
95.00% Confidence Interval ( 299.29 - 300.25 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 512
0.1% Error 51145
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1022
DPS
470 T31_2p Damage Per Second
Count 19721
Mean 185723.00
Minimum 163321.26
Maximum 216632.16
Spread ( max - min ) 53310.90
Range [ ( max - min ) / 2 * 100% ] 14.35%
Standard Deviation 6639.1361
5th Percentile 175281.20
95th Percentile 196956.00
( 95th Percentile - 5th Percentile ) 21674.80
Mean Distribution
Standard Deviation 47.2767
95.00% Confidence Interval ( 185630.34 - 185815.66 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4909
0.1 Scale Factor Error with Delta=300 376277
0.05 Scale Factor Error with Delta=300 1505106
0.01 Scale Factor Error with Delta=300 37627626
Priority Target DPS
470 T31_2p Priority Target Damage Per Second
Count 19721
Mean 185723.00
Minimum 163321.26
Maximum 216632.16
Spread ( max - min ) 53310.90
Range [ ( max - min ) / 2 * 100% ] 14.35%
Standard Deviation 6639.1361
5th Percentile 175281.20
95th Percentile 196956.00
( 95th Percentile - 5th Percentile ) 21674.80
Mean Distribution
Standard Deviation 47.2767
95.00% Confidence Interval ( 185630.34 - 185815.66 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 4909
0.1 Scale Factor Error with Delta=300 376277
0.05 Scale Factor Error with Delta=300 1505106
0.01 Scale Factor Error with Delta=300 37627626
DPS(e)
470 T31_2p Damage Per Second (Effective)
Count 19721
Mean 185723.00
Minimum 163321.26
Maximum 216632.16
Spread ( max - min ) 53310.90
Range [ ( max - min ) / 2 * 100% ] 14.35%
Damage
470 T31_2p Damage
Count 19721
Mean 53952084.05
Minimum 40066563.22
Maximum 68961509.28
Spread ( max - min ) 28894946.06
Range [ ( max - min ) / 2 * 100% ] 26.78%
DTPS
470 T31_2p Damage Taken Per Second
Count 19721
Mean 3903.11
Minimum 833.31
Maximum 7971.01
Spread ( max - min ) 7137.70
Range [ ( max - min ) / 2 * 100% ] 91.44%
HPS
470 T31_2p Healing Per Second
Count 19721
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31_2p Healing Per Second (Effective)
Count 19721
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31_2p Heal
Count 19721
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31_2p Healing Taken Per Second
Count 19721
Mean 3276.05
Minimum 558.10
Maximum 6387.02
Spread ( max - min ) 5828.92
Range [ ( max - min ) / 2 * 100% ] 88.96%
TMI
470 T31_2p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31_2pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31_2p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.50 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.12 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.12 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.13 starsurge,if=variable.starsurge_condition1
R 15.88 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.08 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.02 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.70 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.35 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.14 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 31.23 starsurge,if=variable.starsurge_condition2
Y 114.15 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQQVYXYRXYYWQQQSYYYYXYXYYOXTYXYWQQRQYQYYYYXYSXYYXWQYPPQQRYYQYYXYYQPPQQSUQRVOYXYWQQYPPQQYYQSYRYYQFQYQPPQYYQYYYWQQRSQETUQYQYYYOWQQYPPQRQYYQSYYYQYQYPPQYQRYXYYYQYSQPPYQQQRVTOWQQYQYYPPQQSYQYYRYQQYFYQNUQYVQXXYYWQQRQSYEYYYXYXYYWQQQTYRYYXSYXYOYWQQQYYYPPQQRQUYXYWQYQSYQPPQYQYYYRWQQYYQYPPQSYYYWQQROYQYYYFXVXTYWQQQYSYXPPQRQ

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31_2p 50.0/100: 50% astral_power
Pre precombat 1 food 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31_2p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31_2p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.936 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.873 st L starfire Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.717 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.717 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.717 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.717 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.570 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.390 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.180 st T new_moon Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.933 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.694 st U half_moon Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.709 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.470 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.233 st V full_moon Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), dreamstate(2), corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
0:10.752 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.508 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), dreamstate, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.269 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.024 st R sunfire Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.780 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.535 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.288 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.043 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.043 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.830 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.589 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.345 st S moonfire Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.098 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:19.853 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.607 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:21.361 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.115 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:22.870 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:23.625 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:24.380 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.134 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.889 st O warrior_of_elune Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:25.889 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power
0:26.643 st T new_moon Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.398 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.160 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.922 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.684 st W cancel_buff Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.684 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.536 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.356 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.145 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.934 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:33.695 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:34.457 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:35.217 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:35.979 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:36.742 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:37.504 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:38.266 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:39.026 st S moonfire Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:39.788 st X starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:40.550 st Y wrath Fluffy_Pillow 44.0/100: 44% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
0:41.538 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:42.527 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:43.516 st W cancel_buff Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:43.516 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(28), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:44.622 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:45.688 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:46.444 st P starfire Fluffy_Pillow 52.8/100: 53% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), starlord, warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:47.199 st Q starsurge Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune(2), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:48.264 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune(2), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:49.288 st R sunfire Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:50.277 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), warrior_of_elune(2), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:51.265 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:52.353 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:53.439 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:54.525 st Y wrath Fluffy_Pillow 65.6/100: 66% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:55.610 st X starsurge Fluffy_Pillow 81.6/100: 82% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:56.695 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:57.780 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
0:58.867 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:00.085 st P starfire Fluffy_Pillow 45.6/100: 46% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:01.838 st P starfire Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:02.797 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:03.863 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:04.889 st S moonfire Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:05.789 st U half_moon Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:06.985 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:07.883 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:08.872 st V full_moon Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:10.843 st O warrior_of_elune Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:10.889 st Y wrath Fluffy_Pillow 73.6/100: 74% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:11.643 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:12.630 st Y wrath Fluffy_Pillow 63.6/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:13.618 st W cancel_buff Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:13.618 st Q starsurge Fluffy_Pillow 81.6/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:14.725 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:15.790 st Y wrath Fluffy_Pillow 27.6/100: 28% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:16.814 st P starfire Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:17.567 st P starfire Fluffy_Pillow 56.4/100: 56% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:18.322 st Q starsurge Fluffy_Pillow 75.2/100: 75% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:19.345 st Q starsurge Fluffy_Pillow 43.2/100: 43% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:20.333 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:21.321 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:22.308 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:23.394 st S moonfire Fluffy_Pillow 17.2/100: 17% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:24.479 st Y wrath Fluffy_Pillow 25.2/100: 25% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
1:25.566 st R sunfire Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:26.653 st Y wrath Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:27.740 st Y wrath Fluffy_Pillow 71.2/100: 71% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:28.826 st Q starsurge Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.043 default F natures_vigil 470 T31_2p 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:30.043 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:31.214 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:32.341 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:33.468 st P starfire Fluffy_Pillow 7.2/100: 7% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune, dreamstate, best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:34.222 st P starfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:35.112 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:36.100 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:37.087 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:38.075 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:39.063 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:40.150 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:41.237 st Y wrath Fluffy_Pillow 74.0/100: 74% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:42.324 st W cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:42.324 st Q starsurge Fluffy_Pillow 92.0/100: 92% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:43.541 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:44.710 st R sunfire Fluffy_Pillow 22.0/100: 22% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:45.835 st S moonfire Fluffy_Pillow 34.0/100: 34% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:46.962 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:48.089 default E use_items Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
1:48.089 st T new_moon Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:48.842 st U half_moon Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:50.156 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
1:51.144 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
1:52.130 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:53.119 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:54.109 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:55.098 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:56.088 st O warrior_of_elune Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
1:56.088 st W cancel_buff Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
1:56.088 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(65)
1:57.196 st Q starsurge Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(55)
1:58.261 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(50)
1:59.284 st P starfire Fluffy_Pillow 30.0/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(45)
2:00.039 st P starfire Fluffy_Pillow 48.8/100: 49% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(2), best_friends_with_pip_static, undulating_sporecloak, kindled_soul(45)
2:00.794 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(40)
2:01.820 st R sunfire Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(35)
2:02.809 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(30)
2:03.796 st Y wrath Fluffy_Pillow 7.6/100: 8% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(25)
2:04.784 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, kindled_soul(20)
2:05.773 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_pip_static, kindled_soul(15)
2:06.859 st S moonfire Fluffy_Pillow 9.6/100: 10% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip_static, kindled_soul(10)
2:07.945 st Y wrath Fluffy_Pillow 15.6/100: 16% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip_static, kindled_soul(5)
2:09.031 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip_static
2:10.118 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak
2:11.204 st Q starsurge Fluffy_Pillow 69.6/100: 70% astral_power eclipse_solar, primordial_arcanic_pulsar(28), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:12.420 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:13.591 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord, warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:14.762 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:15.888 st P starfire Fluffy_Pillow 29.6/100: 30% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), warrior_of_elune, dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:16.642 st P starfire Fluffy_Pillow 46.4/100: 46% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_pip_static, undulating_sporecloak
2:17.563 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak
2:18.588 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:19.578 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:20.567 st R sunfire Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:21.556 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(5), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:22.642 st X starsurge Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:23.730 st Y wrath Fluffy_Pillow 2.4/100: 2% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:24.814 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:25.901 st Y wrath Fluffy_Pillow 36.4/100: 36% astral_power eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:26.988 st Q starsurge Fluffy_Pillow 52.4/100: 52% astral_power eclipse_solar, primordial_arcanic_pulsar(48), best_friends_with_pip_static, undulating_sporecloak
2:28.204 st Y wrath Fluffy_Pillow 18.4/100: 18% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, undulating_sporecloak
2:29.375 st S moonfire Fluffy_Pillow 34.4/100: 34% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, undulating_sporecloak
2:30.545 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:31.717 st P starfire Fluffy_Pillow 6.4/100: 6% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
2:33.406 st P starfire Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord(2), dreamstate, best_friends_with_pip_static, undulating_sporecloak
2:34.328 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak
2:35.081 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), best_friends_with_pip_static, undulating_sporecloak
2:36.105 st Q starsurge Fluffy_Pillow 52.4/100: 52% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:37.004 st Q starsurge Fluffy_Pillow 28.4/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:37.902 st R sunfire Fluffy_Pillow 0.4/100: 0% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak
2:38.800 st V full_moon Fluffy_Pillow 10.4/100: 10% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak
2:40.773 st T new_moon Fluffy_Pillow 64.4/100: 64% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak
2:41.528 st O warrior_of_elune Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:41.528 st W cancel_buff Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:41.528 st Q starsurge Fluffy_Pillow 76.4/100: 76% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:42.551 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:43.535 st Y wrath Fluffy_Pillow 22.4/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:44.483 st Q starsurge Fluffy_Pillow 38.4/100: 38% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:45.429 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:46.344 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
2:47.257 st P starfire Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:48.010 st P starfire Fluffy_Pillow 63.2/100: 63% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:48.764 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:49.678 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:50.594 st S moonfire Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:51.509 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:52.422 st Q starsurge Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:53.337 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(32), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:54.343 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:55.349 st R sunfire Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:56.353 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:57.357 st Q starsurge Fluffy_Pillow 80.0/100: 80% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:58.574 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:59.747 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.873 default F natures_vigil 470 T31_2p 26.0/100: 26% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:00.873 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:02.001 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:03.128 st N incarnation_chosen_of_elune Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, denizen_of_the_dream(3), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:03.128 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:04.327 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), warrior_of_elune, dreamstate(2), best_friends_with_urctos_static, undulating_sporecloak
3:05.225 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:05.980 st V full_moon Fluffy_Pillow 28.0/100: 28% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:07.774 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:08.672 st X starsurge Fluffy_Pillow 60.0/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:09.569 st X starsurge Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), dreamstate, best_friends_with_urctos_static, undulating_sporecloak
3:10.557 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:11.312 st Y wrath Fluffy_Pillow 56.0/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:12.301 st W cancel_buff Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:12.301 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, best_friends_with_urctos_static, undulating_sporecloak
3:13.408 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord, best_friends_with_urctos_static, undulating_sporecloak
3:14.473 st R sunfire Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak
3:15.497 st Q starsurge Fluffy_Pillow 36.0/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord(2), best_friends_with_urctos_static, undulating_sporecloak
3:16.522 st S moonfire Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:17.509 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_urctos_static, undulating_sporecloak
3:18.497 default E use_items Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
3:18.497 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:19.485 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
3:20.474 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
3:21.463 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(90)
3:22.451 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
3:23.438 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(4), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
3:24.425 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
3:25.414 st Y wrath Fluffy_Pillow 68.0/100: 68% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
3:26.403 st W cancel_buff Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:26.403 st Q starsurge Fluffy_Pillow 84.0/100: 84% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
3:27.509 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord, best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
3:28.574 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
3:29.598 st T new_moon Fluffy_Pillow 4.0/100: 4% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:30.353 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:31.342 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(40)
3:32.256 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(35)
3:33.172 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(30)
3:34.087 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(25)
3:35.000 st S moonfire Fluffy_Pillow 52.0/100: 52% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(20)
3:35.916 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(15)
3:36.832 st X starsurge Fluffy_Pillow 78.0/100: 78% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(10)
3:37.748 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, kindled_soul(5)
3:38.663 st O warrior_of_elune Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:38.663 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:39.577 st W cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:39.577 st Q starsurge Fluffy_Pillow 86.0/100: 86% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(40), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:40.601 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(44), starlord, warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, wafting_devotion
3:41.586 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, wafting_devotion
3:42.533 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, wafting_devotion
3:43.447 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, wafting_devotion
3:44.361 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), best_friends_with_urctos(2), best_friends_with_urctos_static, wafting_devotion
3:45.276 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:46.031 st P starfire Fluffy_Pillow 66.8/100: 67% astral_power natures_grace, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(2), best_friends_with_urctos_static, undulating_sporecloak
3:46.784 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:47.771 st Q starsurge Fluffy_Pillow 55.6/100: 56% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:48.759 st R sunfire Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak
3:49.658 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:50.489 st U half_moon Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion
3:51.597 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:52.510 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:53.424 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.337 st W cancel_buff Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:54.337 st Q starsurge Fluffy_Pillow 45.6/100: 46% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:55.360 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:56.343 st Q starsurge Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord, warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:57.328 st S moonfire Fluffy_Pillow 7.6/100: 8% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:58.276 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:59.225 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(2), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.173 st P starfire Fluffy_Pillow 5.6/100: 6% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune, dreamstate, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:00.927 st P starfire Fluffy_Pillow 22.4/100: 22% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:01.751 st Q starsurge Fluffy_Pillow 66.4/100: 66% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:02.666 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:03.581 st Q starsurge Fluffy_Pillow 54.4/100: 54% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:04.495 st Y wrath Fluffy_Pillow 20.4/100: 20% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:05.482 st Y wrath Fluffy_Pillow 38.4/100: 38% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:06.470 st Y wrath Fluffy_Pillow 56.4/100: 56% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:07.556 st R sunfire Fluffy_Pillow 74.4/100: 74% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.645 st W cancel_buff Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:08.645 st Q starsurge Fluffy_Pillow 82.4/100: 82% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:09.862 st Q starsurge Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord, best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:11.033 st Y wrath Fluffy_Pillow 12.4/100: 12% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_pip(7), best_friends_with_pip_static, corrupting_rage
4:12.159 st Y wrath Fluffy_Pillow 30.4/100: 30% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_pip(6), best_friends_with_pip_static, corrupting_rage
4:13.285 st Q starsurge Fluffy_Pillow 46.4/100: 46% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(2), best_friends_with_pip(5), best_friends_with_pip_static, corrupting_rage
4:14.411 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(4), best_friends_with_pip_static, corrupting_rage
4:15.498 st P starfire Fluffy_Pillow 30.4/100: 30% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), best_friends_with_pip(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:17.126 st P starfire Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream(2), natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:18.016 st Q starsurge Fluffy_Pillow 58.4/100: 58% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:19.005 st S moonfire Fluffy_Pillow 22.4/100: 22% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), dreamstate, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:19.994 st Y wrath Fluffy_Pillow 32.4/100: 32% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:20.748 st Y wrath Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:21.734 st Y wrath Fluffy_Pillow 70.4/100: 70% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:22.722 st W cancel_buff Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:22.722 st Q starsurge Fluffy_Pillow 86.4/100: 86% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:23.829 st Q starsurge Fluffy_Pillow 50.4/100: 50% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:25.000 st R sunfire Fluffy_Pillow 18.4/100: 18% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:26.128 st O warrior_of_elune Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:26.128 st Y wrath Fluffy_Pillow 24.4/100: 24% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage
4:27.255 st Q starsurge Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(2), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:28.296 st Y wrath Fluffy_Pillow 8.4/100: 8% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:29.301 st Y wrath Fluffy_Pillow 26.4/100: 26% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:30.307 st Y wrath Fluffy_Pillow 44.4/100: 44% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.313 default F natures_vigil 470 T31_2p 60.4/100: 60% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.313 st X starsurge Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.319 st V full_moon Fluffy_Pillow 24.4/100: 24% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_pip_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:34.144 st X starsurge Fluffy_Pillow 80.4/100: 80% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:35.058 st T new_moon Fluffy_Pillow 54.4/100: 54% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:35.813 st Y wrath Fluffy_Pillow 68.4/100: 68% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.727 st W cancel_buff Fluffy_Pillow 88.4/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:36.727 st Q starsurge Fluffy_Pillow 88.4/100: 88% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:37.752 st Q starsurge Fluffy_Pillow 60.4/100: 60% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord, warrior_of_elune(3), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:38.736 st Q starsurge Fluffy_Pillow 36.4/100: 36% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(2), warrior_of_elune(3), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:39.684 st Y wrath Fluffy_Pillow 10.4/100: 10% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:40.599 st S moonfire Fluffy_Pillow 28.4/100: 28% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:41.512 st Y wrath Fluffy_Pillow 34.4/100: 34% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:42.428 st X starsurge Fluffy_Pillow 56.4/100: 56% astral_power natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:43.416 st P starfire Fluffy_Pillow 30.4/100: 30% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:44.170 st P starfire Fluffy_Pillow 49.2/100: 49% astral_power natures_vigil, denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:44.925 st Q starsurge Fluffy_Pillow 68.0/100: 68% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:45.841 st R sunfire Fluffy_Pillow 34.0/100: 34% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:46.755 st Q starsurge Fluffy_Pillow 72.0/100: 72% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 36730 34981 31271
Intellect 2089 0 13776 12951 10246 (6349)
Spirit 0 0 0 0 0
Health 734600 734600 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13776 12951 0
Crit 27.36% 21.15% 2907
Haste 23.68% 23.68% 3817
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14327 13469 0
Mastery 27.84% 27.84% 7080
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31_2p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31271
# gear_intellect=10246
# gear_crit_rating=2907
# gear_haste_rating=3817
# gear_mastery_rating=7080
# gear_versatility_rating=793
# gear_armor=4652
# set_bonus=tier31_2pc=1

470 T31_4p : 202580 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
202580.4 202580.4 101.2 / 0.050% 30229.9 / 14.9% 16112.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Astral Power 0.00% 66.7 100.0% 100%
TalentBYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE
Set Bonus

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
470 T31_4p 202580
Astral Smolder 14641 7.2% 64.5 4.60s 68049 0 Periodic 116.8 37560 0 37560 0.0% 77.9%

Stats Details: Astral Smolder

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.46 0.00 116.79 116.79 48.78 0.0000 2.0000 4386750.23 4386750.23 0.00% 18779.86 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 116.79 72 157 37559.79 8124 131463 37569.95 27152 49181 4386750 4386750 0.00%

Action Details: Astral Smolder

  • id:394061
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH_DURATION

Spelldata

  • id:394061
  • name:Astral Smolder
  • school:astral
  • tooltip:Deals {$=}w1 Astral damage every {$t1=2} sec.
  • description:{$@spelldesc394058=Your critical strikes from Starfire and Wrath cause the target to languish for an additional {$s1=40}% of your spell's damage over {$394061d=6 seconds}.}
Denizen of the Dream 0 (6518) 0.0% (3.2%) 8.6 32.32s 228359 0

Stats Details: Denizen Of The Dream

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.56 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Denizen Of The Dream

  • id:394065
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:394065
  • name:Denizen of the Dream
  • school:physical
  • tooltip:
  • description:Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.
    Fey Missile 11223 3.2% 150.7 1.75s 12973 10026 Direct 149.8 10245 20465 13053 27.5%

Stats Details: Fey Missile

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 150.73 149.81 0.00 0.00 0.00 1.2939 0.0000 1955422.87 1955422.87 0.00% 10026.22 10026.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.52% 108.64 21 261 10245.10 6801 17602 10235.90 9119 11905 1113067 1113067 0.00%
crit 27.48% 41.16 6 119 20464.66 13811 34692 20447.45 18124 24876 842355 842355 0.00%

Action Details: Fey Missile

  • id:188046
  • school:astral
  • range:40.0
  • travel_speed:16.0000
  • radius:0.0
  • trigger_gcd:0.5000
  • gcd_type:spell_speed
  • min_gcd:0.5000
  • cooldown:0.193
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.236000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:188046
  • name:Fey Missile
  • school:astral
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}

Action Priority List

    default
    [ ]:18700.72
Hungering Shadowflame 3046 1.5% 17.2 16.98s 53097 0 Direct 17.2 41619 83278 53095 27.5%

Stats Details: Hungering Shadowflame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.22 17.22 0.00 0.00 0.00 0.0000 0.0000 914502.26 914502.26 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.45% 12.48 2 27 41619.26 27654 160477 41455.82 27775 95179 519411 519411 0.00%
crit 27.55% 4.74 0 16 83277.80 55309 320954 82244.44 0 320954 395091 395091 0.00%

Action Details: Hungering Shadowflame

  • id:424324
  • school:shadowflame
  • range:45.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24191.79
  • base_dd_max:24191.79
  • base_dd_mult:1.00

Spelldata

  • id:424324
  • name:Hungering Shadowflame
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc424320=Your spells and abilities have a chance to draw on the corruption within, dealing an additional {$s1=3192} Shadowflame damage to you and your target. Damage increased by {$s2=400}% against enemies above {$s3=90}% health.}
Launched Thorns 2904 1.4% 34.1 8.64s 25544 0 Direct 34.0 20099 40173 25616 27.5%

Stats Details: Launched Thorns

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 34.10 34.00 0.00 0.00 0.00 0.0000 0.0000 870968.46 870968.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.52% 24.66 8 45 20099.02 19574 22717 20098.61 19715 20957 495568 495568 0.00%
crit 27.48% 9.34 0 25 40172.55 39147 45434 40167.26 0 43721 375400 375400 0.00%

Action Details: Launched Thorns

  • id:379403
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17122.72
  • base_dd_max:17122.72
  • base_dd_mult:1.00

Spelldata

  • id:379403
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379395=Launches magical thorns at the target, dealing {$379396s3=3765} Nature damage.}
Moonfire 11025 5.4% 14.3 21.61s 230192 237161 Direct 14.3 8138 16666 11075 34.4%
Periodic 309.6 7351 15343 10157 35.1% 99.6%

Stats Details: Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 309.58 309.58 13.35 0.9707 0.9646 3303183.79 3303183.79 0.00% 10568.56 237161.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 65.56% 9.41 1 17 8137.83 5319 15267 8133.58 6615 10454 76563 76563 0.00%
crit 34.44% 4.94 0 13 16666.47 10757 29655 16618.33 0 24959 82355 82355 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 64.89% 200.88 139 271 7350.51 627 13294 7354.35 6957 7896 1476601 1476601 0.00%
crit 35.11% 108.69 66 164 15342.61 795 26587 15352.70 14084 16838 1667664 1667664 0.00%

Action Details: Moonfire

  • id:8921
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Moonfire Dmg

  • id:164812
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:15.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:2
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.15

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.15
  • dot_duration:22.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164812
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering {$=}w2 Arcane damage every {$t2=2} seconds.
  • description:{$@spelldesc8921=A quick beam of lunar light burns the enemy for {$164812s1=0 + 20.0%} Arcane damage and then an additional {$164812=}o2 Arcane damage over {$164812d=18 seconds}{$?s238049=false}[, and causes enemies to deal {$238049s1=1}% less damage to you.][.]{$?a372567=false}[ Hits a second target within {$279620s1=15} yds of the first.][]{$?s197911=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][] }

Action Priority List

    st
    [K]:1.25
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [S]:13.10
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell DurationMoonfire3266461ADD4000.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
Spell Direct AmountTwin Moons2796202PCT0.100
Spell Periodic AmountTwin Moons2796203PCT0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
New Moon (Talent) 0 (19233) 0.0% (9.5%) 17.0 17.97s 339330 284257

Stats Details: Moons Talent

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.99 0.00 0.00 0.00 0.00 1.1938 0.0000 0.00 0.00 0.00% 284256.61 284256.61

Action Details: Moons Talent

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
    Full Moon 7001 3.5% 5.3 63.20s 397342 214520 Direct 5.3 275917 541764 399828 46.6%

Stats Details: Full Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.30 5.26 0.00 0.00 0.00 1.8523 0.0000 2104867.85 2104867.85 0.00% 214519.76 214519.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.38% 2.81 0 6 275916.53 169147 455690 270866.51 0 449236 775407 775407 0.00%
crit 46.62% 2.45 0 6 541764.19 340122 922954 518082.02 0 886111 1329461 1329461 0.00%

Action Details: Full Moon

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:50.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Action Priority List

    st
    [V]:5.36
  • if_expr:astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    New Moon 5284 2.6% 6.0 53.68s 262923 348479 Direct 6.0 174211 362415 264589 48.0%

Stats Details: New Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 5.97 0.00 0.00 0.00 0.7545 0.0000 1580351.58 1580351.58 0.00% 348478.85 348478.85
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 51.98% 3.10 0 7 174210.87 84261 268860 171958.65 0 260218 540828 540828 0.00%
crit 48.02% 2.87 0 7 362415.08 179505 544417 357961.38 0 522145 1039524 1039524 0.00%

Action Details: New Moon

  • id:274281
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.0000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:12.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274281
  • name:New Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates {$=}{{$m3=120}/10} Astral Power.|r

Action Priority List

    st
    [T]:6.03
  • if_expr:astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Half Moon 6947 3.4% 5.7 57.98s 366072 299593 Direct 5.6 239702 477323 368178 54.1%

Stats Details: Half Moon

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.68 5.65 0.00 0.00 0.00 1.2220 0.0000 2080073.11 2080073.11 0.00% 299592.84 299592.84
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 45.93% 2.59 0 7 239702.39 119056 386535 231688.22 0 386535 622030 622030 0.00%
crit 54.07% 3.05 0 7 477323.01 242252 773071 470317.08 0 760316 1458043 1458043 0.00%

Action Details: Half Moon

  • id:274282
  • school:astral
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:24.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.875000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274282
  • name:Half Moon
  • school:astral
  • tooltip:
  • description:Deals {$s1=0} Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates {$=}{{$m3=240}/10} Astral Power.|r

Action Priority List

    st
    [U]:5.71
  • if_expr:astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Shooting Stars 0 (17814) 0.0% (8.8%) 0.0 0.00s 0 0

Stats Details: Shooting Stars

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Shooting Stars

  • id:202342
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202342
  • name:Shooting Stars
  • school:physical
  • tooltip:
  • description:Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Tick TimeCosmic Rapidity4000591PCT-0.250
    Shooting Stars (Moonfire) 6656 3.3% 94.7 3.15s 21076 0 Direct 94.4 14283 29880 21134 43.9%

Stats Details: Shooting Stars Moonfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.67 94.41 0.00 0.00 0.00 0.0000 0.0000 1995172.04 1995172.04 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.08% 52.94 21 89 14282.69 8489 28334 14288.13 12685 16513 756125 756125 0.00%
crit 43.92% 41.47 19 70 29879.51 16978 56668 29892.33 25641 34459 1239047 1239047 0.00%

Action Details: Shooting Stars Moonfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Shooting Stars (Sunfire) 6663 3.3% 95.0 3.15s 21037 0 Direct 94.7 14263 29851 21094 43.8%

Stats Details: Shooting Stars Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 94.96 94.70 0.00 0.00 0.00 0.0000 0.0000 1997605.20 1997605.20 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.18% 53.20 20 94 14263.25 8489 28334 14269.15 12551 16921 758790 758790 0.00%
crit 43.82% 41.50 18 73 29851.07 16978 56668 29864.31 25947 35361 1238815 1238815 0.00%

Action Details: Shooting Stars Sunfire

  • id:202497
  • school:astral
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:2.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.205000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating {$=}{{$202497m2=20}/10} Astral Power.}

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Orbit Breaker 4494 2.2% 6.3 48.04s 213210 0 Direct 6.3 144494 301724 213769 44.1%

Stats Details: Orbit Breaker

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.32 6.30 0.00 0.00 0.00 0.0000 0.0000 1347022.83 1347022.83 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 55.93% 3.52 0 9 144494.25 85720 286103 143116.48 0 262320 509227 509227 0.00%
crit 44.07% 2.78 0 8 301723.98 171441 572207 293690.06 0 539550 837796 837796 0.00%

Action Details: Orbit Breaker

  • id:274283
  • school:astral
  • range:45.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:3
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:1
  • full_amount_targets:1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:30.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.450000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:274283
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals {$m1=0} Astral damage to the target and nearby enemies, and resets Full Moon to become New Moon. Deals reduced damage to secondary targets. |cFFFFFFFFGenerates {$=}{{$m2=500}/10} Astral Power.|r

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
Starfire 5126 2.5% 26.1 11.46s 59005 65628 Direct 27.1 40510 80779 56829 40.5%

Stats Details: Starfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 26.10 27.10 0.00 0.00 0.00 0.8991 0.0000 1540037.13 1540037.13 0.00% 65628.45 65628.45
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 59.48% 16.12 5 30 40509.55 17841 75751 40520.93 32360 47238 652949 652949 0.00%
crit 40.52% 10.98 2 24 80778.69 35681 163266 80767.95 57008 100897 887088 887088 0.00%

Action Details: Starfire

  • id:194153
  • school:arcane
  • range:45.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • reduced_aoe_targets:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:astral_power
  • energize_amount:10.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.650250
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:194153
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:Call down a burst of energy, causing {$s1=0 + 65.0%} Arcane damage to the target, and {$=}{{$m1=0}*{$m3=33}/100} Arcane damage to all other enemies within {$=}A1 yards. Deals reduced damage beyond {$s5=8} targets. |cFFFFFFFFGenerates {$=}{{$m2=100}/10} Astral Power.|r

Action Priority List

    st
    [L]:1.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
    st
    [P]:25.16
  • if_expr:variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Owlkin Frenzy1572281-1.000Spell Data
Warrior of Elune2024251-1.000Spell DataNo-stacks
Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Moonfire16481240.283Mastery
Waning Twilight39395710.100
Starsurge 65396 (88330) 32.3% (43.6%) 115.5 2.59s 229040 231421 Direct 115.2 (153.2) 117623 242821 169934 41.8% (42.3%)

Stats Details: Starsurge

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.46 115.21 0.00 0.00 0.00 0.9897 0.0000 19578413.02 19578413.02 0.00% 231420.64 231420.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 58.22% 67.07 35 100 117623.37 77605 225234 117688.48 106893 130639 7889325 7889325 0.00%
crit 41.78% 48.14 24 76 242820.53 155211 450468 243009.06 215395 279830 11689088 11689088 0.00%

Action Details: Starsurge

  • id:78674
  • school:astral
  • range:45.0
  • travel_speed:45.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:astral_power
  • base_cost:36.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.455000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.18

Spelldata

  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$s1=0} Astral damage.

Action Priority List

    st
    [Q]:84.10
  • if_expr:variable.starsurge_condition1
    st
    [X]:31.36
  • if_expr:variable.starsurge_condition2

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountRattle the Stars3939541PCT0.120
Spell Resource CostRattle the Stars3939542PCT-0.100

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301420.600Spell DataMastery
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Lunar)4851870.150Current Value
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Flat Cost Incarnation: Chosen of Elune1025603-8.000Spell Data
Dot / Debuff on Target Moonfire16481240.283Mastery
Sunfire16481540.283Mastery
Waning Twilight39395710.100
    Goldrinn's Fang 22935 11.3% 38.1 7.79s 180027 0 Direct 38.0 123749 253739 180913 44.0%

Stats Details: Goldrinns Fang

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 37.95 0.00 0.00 0.00 0.0000 0.0000 6866254.57 6866254.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 56.02% 21.26 5 41 123749.29 81149 235517 123819.11 102076 153325 2631247 2631247 0.00%
crit 43.98% 16.69 3 35 253739.20 162297 471034 253896.11 203706 326822 4235007 4235007 0.00%

Action Details: Goldrinns Fang

  • id:394047
  • school:astral
  • range:60.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.852000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:2.10

Spelldata

  • id:394047
  • name:Goldrinn's Fang
  • school:astral
  • tooltip:Deals {$m1=0} Arcane damage.
  • description:Deals {$m1=0} Arcane damage.

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Direct AmountPower of Goldrinn3940462PCT1.000

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Friend of the Fae39408310.100Spell Data
Eclipse (Lunar)4851810.150Current Value
Eclipse (Solar)4851710.150Current Value
Mastery: Astral Invocation39301410.600Spell DataMastery
Mastery: Astral Invocation39301430.600Spell DataMastery
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Incarnation: Chosen of Elune10256020.100Spell Data
Balance of All Things39405010.020Spell Data
Balance of All Things39404910.020Spell Data
Dot / Debuff on Target Moonfire16481250.283Mastery
Sunfire16481550.283Mastery
Waning Twilight39395710.100
Sunfire 11051 5.5% 17.4 18.05s 190399 195695 Direct 17.4 8140 16462 11340 38.5%
Periodic 310.5 7247 14686 10033 37.5% 99.9%

Stats Details: Sunfire

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 310.55 310.55 16.40 0.9730 0.9646 3313116.09 3313116.09 0.00% 10468.44 195694.98
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 61.54% 10.71 2 20 8140.44 4862 14137 8133.76 6916 9543 87179 87179 0.00%
crit 38.46% 6.69 0 16 16461.91 9724 28825 16458.49 0 22120 110159 110159 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 62.55% 194.23 127 260 7247.23 51 12669 7246.80 6828 7643 1407629 1407629 0.00%
crit 37.45% 116.31 72 176 14685.62 16 25338 14687.01 13855 15734 1708149 1708149 0.00%

Action Details: Sunfire

  • id:93402
  • school:nature
  • range:45.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:6.0

Spelldata

  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=0} sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]

Action Details: Sunfire Dmg

  • id:164815
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:false
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.200000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • tick_on_application:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.174000
  • base_td:0.00
  • base_td_mult:1.05
  • dot_duration:18.00
  • base_tick_time:1.50
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH_PANDEMIC

Spelldata

  • id:164815
  • name:Sunfire
  • school:nature
  • tooltip:Suffering {$=}w2 Nature damage every {$t2=2} seconds.
  • description:{$@spelldesc93402=A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional {$164815=}o2 Nature damage over {$164815d=18 seconds}{$?s231050=true}[ to the primary target and all enemies within {$164815=}A2 yards][].{$?s137013=true}[ |cFFFFFFFFGenerates {$=}{{$m3=0}/10} Astral Power.|r][]}

Action Priority List

    st
    [J]:1.50
  • target_if_expr:refreshable&remains<2&(target.time_to_die-remains)>6
    st
    [R]:15.90
  • target_if_expr:refreshable&astral_power.deficit>variable.passive_asp+3

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Tick TimeCosmic Rapidity4000591PCT-0.250

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Tindral's Fowl Fantasia 0 (3243) 0.0% (1.6%) 8.6 31.67s 113752 0

Stats Details: Tindrals Fowl Fantasia

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.55 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Tindrals Fowl Fantasia

  • id:426341
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:426341
  • name:Tindral's Fowl Fantasia
  • school:physical
  • tooltip:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
  • description:Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.
    Denizen of the Flame 1688 0.8% 8.6 31.67s 59227 0 Direct 8.6 46435 92796 59228 27.6%

Stats Details: Denizen Of The Flame

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 8.55 8.55 0.00 0.00 0.00 0.0000 0.0000 506389.15 506389.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.41% 6.19 0 17 46435.30 45178 52434 46424.34 0 52434 287480 287480 0.00%
crit 27.59% 2.36 0 10 92795.62 90357 104867 85013.71 0 104867 218909 218909 0.00%

Action Details: Denizen Of The Flame

  • id:426486
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39522.22
  • base_dd_max:39522.22
  • base_dd_mult:1.00

Spelldata

  • id:426486
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
    Denizen of the Flame (_secondary) 1554 0.8% 16.6 15.30s 28138 0 Direct 16.6 22083 44134 28138 27.5%

Stats Details: Denizen Of The Flame Secondary

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 16.57 16.57 0.00 0.00 0.00 0.0000 0.0000 466193.77 466193.77 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 72.54% 12.02 1 32 22082.93 21497 24950 22082.08 21551 23768 265405 265405 0.00%
crit 27.46% 4.55 0 16 44134.37 42995 49900 43506.11 0 49900 200788 200788 0.00%

Action Details: Denizen Of The Flame Secondary

  • id:426431
  • school:fire
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • split_aoe_damage:true
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:18805.57
  • base_dd_max:18805.57
  • base_dd_mult:1.00

Spelldata

  • id:426431
  • name:Denizen of the Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc426341=Your harmful spells and abilities have a chance to summon a parliament of blazing spirit owls to divebomb your target, dealing {$=}{{$425838=}w6*2+{$425838=}w8} Fire damage split between all nearby targets. Damage increased per enemy struck, up to 5.}
Wrath 19650 9.7% 115.9 2.53s 50785 53564 Direct 115.5 34193 70427 50968 46.3%

Stats Details: Wrath

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 115.95 115.53 0.00 0.00 0.00 0.9481 0.0000 5888450.46 5888450.46 0.00% 53563.51 53563.51
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 53.70% 62.05 34 94 34192.88 13246 109490 34195.15 29936 38637 2121564 2121564 0.00%
crit 46.30% 53.49 29 84 70427.21 26492 218980 70449.11 61163 82060 3766887 3766887 0.00%

Action Details: Wrath

  • id:190984
  • school:nature
  • range:45.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.12
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:on_hit
  • energize_resource:astral_power
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.570000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.05

Spelldata

  • id:190984
  • name:Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of energy at the target, dealing {$s1=0} Nature damage.{$?a197911=true}[ |cFFFFFFFFGenerates {$=}{{$m2=0}/10} Astral Power.|r][]

Action Priority List

    st
    [M]:0.00
  • if_expr:buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
    st
    [Y]:114.25

Affected By (Passive)

Type Spell ID # +/% Value
Spell Direct AmountBalance Druid1370131PCT-0.010
Spell Periodic AmountBalance Druid1370132PCT-0.010
Spell RangeAstral Influence1975241ADD5.000
Spell Direct AmountNurturing Instinct338731PCT0.060
Spell Periodic AmountNurturing Instinct338732PCT0.060
Spell Critical ChanceWild Surges4068901ADD0.120

Affected By (Dynamic)

Type Spell ID # Value Source Notes
Direct Damage Moonkin Form2485890.100Spell Data
Rising Light, Falling Night - Day41771410.030Spell Data
Mastery: Astral Invocation39301430.600Spell DataMastery
Eclipse (Solar)4851720.400Spell Data
Eclipse (Solar)4851710.150Current Value
Friend of the Fae39408310.100Spell Data
Dreamstate42424831.000Spell DataNo-stacks, Conditional
Periodic Damage Moonkin Form24858100.100Spell Data
Rising Light, Falling Night - Day41771420.030Spell Data
Mastery: Astral Invocation39301440.600Spell DataMastery
Eclipse (Solar)4851780.150Current Value
Friend of the Fae39408320.100Spell Data
Critical Strike Chance Balance of All Things39404910.020Spell Data
Incarnation: Chosen of Elune10256020.100Spell Data
Execute Time Dreamstate4242481-0.400Spell DataNo-stacks, Conditional
Dot / Debuff on Target Sunfire16481540.283Mastery
Waning Twilight39395710.100
Simple Action Stats Execute Interval
470 T31_4p
Draconic Augmentation 1.0 0.00s

Stats Details: Augmentation

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Augmentation

  • id:393438
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Iced Phial of Corrupting Rage 1.0 0.00s

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:374000
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Well Fed 1.0 0.00s

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:396092
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Incarnation: Chosen of Elune 2.0 185.33s

Stats Details: Incarnation Chosen Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Incarnation Chosen Of Elune

  • id:102560
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.

Action Priority List

    st
    [N]:2.00
  • if_expr:variable.cd_condition_st

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Launched Thorns (Heal) 0.6 78.16s

Stats Details: Launched Thorns Heal

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 0.65 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Launched Thorns Heal

  • id:379407
  • school:nature
  • range:100.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28537.86
  • base_dd_max:28537.86
  • base_dd_mult:1.00

Spelldata

  • id:379407
  • name:Launched Thorns
  • school:nature
  • tooltip:
  • description:{$@spelldesc379405=Launches magical thorns at the target, healing them for {$379396s2=42}.}
Moonkin Form 1.0 0.00s

Stats Details: Moonkin Form

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Moonkin Form

  • id:24858
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.

Affected By (Passive)

Type Spell ID # +/% Value
Hasted Global CooldownDruid1370094SET1.000
Nature's Vigil 3.7 90.32s

Stats Details: Natures Vigil

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 3.74 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Natures Vigil

  • id:124974
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:90.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:470 T31_4p
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:124974
  • name:Nature's Vigil
  • school:nature
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].

Action Priority List

    default
    [F]:3.74
Elemental Potion of Ultimate Power 1.5 306.73s

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.48 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:371028
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    default
    [D]:1.47
  • if_expr:!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
Warrior of Elune 6.1 48.46s

Stats Details: Warrior Of Elune

Type Executes Direct Results Ticks Tick Results Refreshes Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.13 0.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Warrior Of Elune

  • id:202425
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:45.000
  • cooldown hasted:false
  • charges:1
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:202425
  • name:Warrior of Elune
  • school:arcane
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.

Action Priority List

    st
    [O]:6.13
  • if_expr:variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Balance of All Things (Arcane) 8.7 1.5 36.5s 33.8s 8.6s 24.91% 28.79% 1.5 (7.2) 8.5

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_of_all_things_arcane
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 50.6s
  • trigger_min/max:2.7s / 50.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 16.0s
  • uptime_min/max:22.06% / 27.80%

Stack Uptimes

  • balance_of_all_things_arcane_1:2.85%
  • balance_of_all_things_arcane_2:2.92%
  • balance_of_all_things_arcane_3:2.99%
  • balance_of_all_things_arcane_4:3.02%
  • balance_of_all_things_arcane_5:3.04%
  • balance_of_all_things_arcane_6:3.29%
  • balance_of_all_things_arcane_7:3.40%
  • balance_of_all_things_arcane_8:3.40%

Spelldata

  • id:394050
  • name:Balance of All Things
  • tooltip:Critical strike chance with Arcane spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Balance of All Things (Nature) 18.1 3.5 17.0s 14.1s 8.4s 50.48% 54.55% 3.5 (20.0) 17.5

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_of_all_things_nature
  • max_stacks:8
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Trigger Details

  • interval_min/max:8.0s / 51.0s
  • trigger_min/max:0.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 22.0s
  • uptime_min/max:46.05% / 54.45%

Stack Uptimes

  • balance_of_all_things_nature_1:5.85%
  • balance_of_all_things_nature_2:5.95%
  • balance_of_all_things_nature_3:6.07%
  • balance_of_all_things_nature_4:6.19%
  • balance_of_all_things_nature_5:6.34%
  • balance_of_all_things_nature_6:6.50%
  • balance_of_all_things_nature_7:6.68%
  • balance_of_all_things_nature_8:6.92%

Spelldata

  • id:394049
  • name:Balance of All Things
  • tooltip:Critical strike chance with Nature spells increased {$=}w1%.
  • description:{$@spelldesc394048=Entering Eclipse increases your critical strike chance with Arcane or Nature spells by {$=}{{$s1=2}*{$394049u=8}}%, decreasing by {$s1=2}% every {$394049t2=1} sec.}
  • max_stacks:8
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_lunar) 7.1 61.9 44.8s 4.2s 20.2s 48.26% 0.00% 34.1 (34.1) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_lunar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:0.8s / 43.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:42.78% / 55.00%

Stack Uptimes

  • balance_t31_4pc_buff_lunar_1:4.77%
  • balance_t31_4pc_buff_lunar_2:4.38%
  • balance_t31_4pc_buff_lunar_3:5.10%
  • balance_t31_4pc_buff_lunar_4:5.59%
  • balance_t31_4pc_buff_lunar_5:28.43%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Druid Balance 10.2 Class Set 4pc (balance_t31_4pc_buff_solar) 14.2 101.2 21.7s 2.6s 19.1s 90.34% 0.00% 47.3 (47.3) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_balance_t31_4pc_buff_solar
  • max_stacks:5
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 58.0s
  • trigger_min/max:0.8s / 10.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:86.64% / 93.68%

Stack Uptimes

  • balance_t31_4pc_buff_solar_1:7.80%
  • balance_t31_4pc_buff_solar_2:12.15%
  • balance_t31_4pc_buff_solar_3:15.98%
  • balance_t31_4pc_buff_solar_4:11.54%
  • balance_t31_4pc_buff_solar_5:42.86%

Spelldata

  • id:422863
  • name:Druid Balance 10.2 Class Set 4pc
  • tooltip:
  • description:Starsurge or Starfall increase your current Eclipse's Arcane or Nature damage bonus by an additional {$s1=2}%, up to {$s2=10}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Best Friends with Aerwynn 2.8 0.0 70.2s 70.2s 10.8s 10.08% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 335.4s
  • trigger_min/max:12.0s / 335.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 35.83%

Stack Uptimes

  • best_friends_with_aerwynn_1:0.90%
  • best_friends_with_aerwynn_2:0.90%
  • best_friends_with_aerwynn_3:0.91%
  • best_friends_with_aerwynn_4:0.91%
  • best_friends_with_aerwynn_5:0.91%
  • best_friends_with_aerwynn_6:0.92%
  • best_friends_with_aerwynn_7:0.92%
  • best_friends_with_aerwynn_8:0.92%
  • best_friends_with_aerwynn_9:0.93%
  • best_friends_with_aerwynn_10:0.93%
  • best_friends_with_aerwynn_11:0.93%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Aerwynn (_static) 2.2 0.9 113.5s 70.2s 45.6s 33.42% 0.00% 69.7 (69.7) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_aerwynn_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:crit_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.5s / 356.5s
  • trigger_min/max:12.0s / 335.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 331.9s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_aerwynn_static_1:33.42%

Spelldata

  • id:426676
  • name:Best Friends with Aerwynn
  • tooltip:Critical Strike increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip 2.8 0.0 70.6s 70.6s 10.8s 9.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_pip
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 343.3s
  • trigger_min/max:12.0s / 343.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 42.94%

Stack Uptimes

  • best_friends_with_pip_1:0.89%
  • best_friends_with_pip_2:0.89%
  • best_friends_with_pip_3:0.90%
  • best_friends_with_pip_4:0.90%
  • best_friends_with_pip_5:0.90%
  • best_friends_with_pip_6:0.91%
  • best_friends_with_pip_7:0.91%
  • best_friends_with_pip_8:0.91%
  • best_friends_with_pip_9:0.91%
  • best_friends_with_pip_10:0.92%
  • best_friends_with_pip_11:0.92%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Pip (_static) 2.2 0.9 114.3s 70.6s 45.4s 33.04% 0.00% 69.3 (69.3) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_pip_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:mastery_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.7s / 354.1s
  • trigger_min/max:12.0s / 343.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 334.1s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_pip_static_1:33.04%

Spelldata

  • id:426647
  • name:Best Friends with Pip
  • tooltip:Mastery increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos 2.8 0.0 70.0s 70.0s 10.8s 10.13% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_urctos
  • max_stacks:11
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.0s / 343.9s
  • trigger_min/max:12.0s / 343.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 11.0s
  • uptime_min/max:0.00% / 36.03%

Stack Uptimes

  • best_friends_with_urctos_1:0.91%
  • best_friends_with_urctos_2:0.91%
  • best_friends_with_urctos_3:0.91%
  • best_friends_with_urctos_4:0.91%
  • best_friends_with_urctos_5:0.92%
  • best_friends_with_urctos_6:0.92%
  • best_friends_with_urctos_7:0.92%
  • best_friends_with_urctos_8:0.93%
  • best_friends_with_urctos_9:0.93%
  • best_friends_with_urctos_10:0.93%
  • best_friends_with_urctos_11:0.94%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Best Friends with Urctos (_static) 2.2 0.9 113.8s 70.0s 45.7s 33.55% 0.00% 69.6 (69.6) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_best_friends_with_urctos_static
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Details

  • stat:versatility_rating
  • amount:266.45

Trigger Details

  • interval_min/max:12.8s / 346.7s
  • trigger_min/max:12.0s / 343.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 324.7s
  • uptime_min/max:0.00% / 100.00%

Stack Uptimes

  • best_friends_with_urctos_static_1:33.55%

Spelldata

  • id:426672
  • name:Best Friends with Urctos
  • tooltip:Versatility increased by {$=}w1.
  • description:{$@spelldesc422858=Join the Dream Team, gaining {$=}{{$s1=1056}/{$426647d=12 seconds}} of Pip's Mastery, Urctos's Versatility, or Aerwynn's Critical Strike based on your current Best Friend. Your spells and abilities have a chance to tag in a random new Best Friend, granting you their passive bonus and empowering it to {$s1=1056} before diminishing over 12 sec.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0s 0.0s 40.0s 13.51% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s
  • uptime_min/max:11.11% / 16.67%

Stack Uptimes

  • bloodlust_1:13.51%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$=}w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Corrupting Rage 4.9 0.0 62.0s 58.5s 50.2s 80.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_corrupting_rage
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:crit_rating
  • amount:1118.00

Trigger Details

  • interval_min/max:15.0s / 346.0s
  • trigger_min/max:15.0s / 321.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.1s
  • uptime_min/max:41.01% / 100.00%

Stack Uptimes

  • corrupting_rage_1:80.21%

Spelldata

  • id:374002
  • name:Corrupting Rage
  • tooltip:Critical Strike increased by {$=}w1. Upon suffering a total of {$=}w2% of your health damage, convert to Overwhelming Rage.
  • description:{$@spelldesc374000=Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Denizen of the Dream 8.6 0.0 45.0s 31.9s 41.3s 57.44% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_denizen_of_the_dream
  • max_stacks:10
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 326.9s
  • trigger_min/max:0.0s / 142.8s
  • trigger_pct:99.98%
  • duration_min/max:0.0s / 253.7s
  • uptime_min/max:20.57% / 94.73%

Stack Uptimes

  • denizen_of_the_dream_1:38.63%
  • denizen_of_the_dream_2:14.48%
  • denizen_of_the_dream_3:3.57%
  • denizen_of_the_dream_4:0.65%
  • denizen_of_the_dream_5:0.10%
  • denizen_of_the_dream_6:0.02%
  • denizen_of_the_dream_7:0.01%
  • denizen_of_the_dream_8:0.01%

Spelldata

  • id:394076
  • name:Denizen of the Dream
  • tooltip:
  • description:{$@spelldesc394065=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$394076d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Dreamstate 15.4 0.5 20.1s 20.6s 3.1s 15.88% 21.19% 0.5 (0.8) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_dreamstate
  • max_stacks:2
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.5s / 56.3s
  • trigger_min/max:0.0s / 54.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.7s
  • uptime_min/max:9.19% / 26.83%

Stack Uptimes

  • dreamstate_1:9.63%
  • dreamstate_2:6.24%

Spelldata

  • id:424248
  • name:Dreamstate
  • tooltip:Wrath and Starfire damage increased by {$s3=100}% and cast time reduced by {$s1=40}%.
  • description:{$@spelldesc422862=When Eclipse ends or when you enter combat, enter a Dreamstate, reducing the cast time of your next {$s3=2} Starfires or Wraths by {$s1=40}% and increasing their damage by {$s2=100}%.}
  • max_stacks:2
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Eclipse (Lunar) 7.1 1.0 45.2s 44.8s 20.6s 49.33% 52.51% 1.0 (1.0) 6.8

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_eclipse_lunar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:12.0s / 89.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:44.08% / 56.13%

Stack Uptimes

  • eclipse_lunar_1:49.33%

Spelldata

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Arcane spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, area effect damage increased {$=}w5%,][] and Starfire deals {$=}w2% increased damage to nearby enemies.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Eclipse (Solar) 13.8 5.7 22.4s 15.7s 20.1s 92.80% 96.05% 5.7 (5.7) 12.9

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_eclipse_solar
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 70.5s
  • trigger_min/max:0.0s / 55.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 68.9s
  • uptime_min/max:90.51% / 95.25%

Stack Uptimes

  • eclipse_solar_1:92.80%

Spelldata

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Nature spells deal {$=}w1% additional damage{$?=}<{$=}w5>0>[, Astral Power generation increased {$=}w5%,][] and Wrath's damage is increased by {$=}w2%.
  • description:{$@spelldesc79577=Casting {$s1=2} {$=}lStarfire:Starfires; empowers Wrath for {$48517d=15 seconds}. Casting {$s1=2} {$=}lWrath:Wraths; empowers Starfire for {$48518d=15 seconds}. {$@=}spellicon48517 {$@=}spellname48517 Nature spells deal {$48517s1=15}% additional damage and Wrath damage is increased by {$48517s2=40}%. {$@=}spellicon48518 {$@=}spellname48518 Arcane spells deal {$48518s1=15}% additional damage and the damage Starfire deals to nearby enemies is increased by {$48518s2=30}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Potion of Ultimate Power 1.5 0.0 307.0s 307.0s 27.4s 13.21% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_elemental_potion_of_ultimate_power
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Elemental Potion of Ultimate Power

Stat Details

  • stat:intellect
  • amount:886.00

Trigger Details

  • interval_min/max:300.0s / 328.3s
  • trigger_min/max:300.0s / 328.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s
  • uptime_min/max:9.87% / 18.02%

Stack Uptimes

  • elemental_potion_of_ultimate_power_1:13.21%

Spelldata

  • id:371028
  • name:Elemental Potion of Ultimate Power
  • tooltip:Primary stat increased by {$=}w1.
  • description:Drink to increase your primary stat by {$s1=449} for {$d=30 seconds}.
  • max_stacks:0
  • duration:30.00
  • cooldown:300.00
  • default_chance:0.00%
Friend of the Fae 5.2 3.3 55.4s 31.9s 25.0s 43.57% 43.53% 3.3 (3.3) 4.8

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_friend_of_the_fae
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:20.0s / 183.3s
  • trigger_min/max:0.0s / 142.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 139.8s
  • uptime_min/max:13.72% / 82.74%

Stack Uptimes

  • friend_of_the_fae_1:43.57%

Spelldata

  • id:394083
  • name:Friend of the Fae
  • tooltip:Arcane and Nature damage increased by {$=}w1%.
  • description:{$@spelldesc394081=When a Faerie Dragon is summoned, your spells deal {$394083m1=10}% increased damage for {$394083d=20 seconds}.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 7.1 0.0 44.8s 44.8s 20.3s 48.41% 51.25% 0.0 (0.0) 6.8

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 89.9s
  • trigger_min/max:12.0s / 89.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.0s
  • uptime_min/max:43.34% / 55.00%

Stack Uptimes

  • incarnation_chosen_of_elune_1:48.41%

Spelldata

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Both Eclipses active. Critical strike chance increased by {$=}w2%{$?s194223=true}[ and haste increased by {$=}w1%][].
  • description:An improved Moonkin Form that grants both Eclipses, any learned Celestial Alignment bonuses, and {$s2=10}% critical strike chance. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Kindled Soul 3.6 0.0 99.6s 99.6s 19.5s 23.28% 0.00% 0.0 (0.0) 3.2

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_kindled_soul
  • max_stacks:100
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00
  • associated item:Balefire Branch

Stat Details

  • stat:intellect
  • amount:55.09

Trigger Details

  • interval_min/max:90.0s / 126.3s
  • trigger_min/max:90.0s / 126.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s
  • uptime_min/max:20.24% / 26.35%

Stack Uptimes

  • kindled_soul_5:1.11%
  • kindled_soul_10:1.14%
  • kindled_soul_15:1.14%
  • kindled_soul_20:1.15%
  • kindled_soul_25:1.15%
  • kindled_soul_30:1.15%
  • kindled_soul_35:1.16%
  • kindled_soul_40:1.16%
  • kindled_soul_45:1.16%
  • kindled_soul_50:1.16%
  • kindled_soul_55:1.17%
  • kindled_soul_60:1.17%
  • kindled_soul_65:1.17%
  • kindled_soul_70:1.18%
  • kindled_soul_75:1.18%
  • kindled_soul_80:1.18%
  • kindled_soul_85:1.18%
  • kindled_soul_90:1.19%
  • kindled_soul_95:1.19%
  • kindled_soul_100:1.19%

Spelldata

  • id:268998
  • name:Kindled Soul
  • tooltip:Intellect increased by {$=}w1.
  • description:{$@spelldesc268999=Kindle your soul, gaining {$=}{{$268998=}U1*{$268998s1=17}} Intellect, which decays over {$=}D or when taking damage.}
  • max_stacks:100
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Nature's Grace 12.9 0.0 20.6s 20.6s 5.9s 25.43% 0.00% 0.0 (0.0) 12.6

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.8s / 70.4s
  • trigger_min/max:12.8s / 70.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 6.0s
  • uptime_min/max:19.62% / 30.18%

Stack Uptimes

  • natures_grace_1:25.43%

Spelldata

  • id:393959
  • name:Nature's Grace
  • tooltip:Haste increased by {$s1=10}%.
  • description:{$@spelldesc393958=After an Eclipse ends, you gain {$393959s1=10}% Haste for {$393959d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Vigil 3.7 0.0 90.3s 90.3s 14.7s 18.41% 0.00% 0.0 (0.0) 3.6

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.50

Trigger Details

  • interval_min/max:90.0s / 92.0s
  • trigger_min/max:90.0s / 92.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:16.56% / 21.04%

Stack Uptimes

  • natures_vigil_1:18.41%

Spelldata

  • id:124974
  • name:Nature's Vigil
  • tooltip:{$?s137012=false}[Single-target healing also damages a nearby enemy target for {$=}w3% of the healing done][Single-target damage also heals a nearby friendly target for {$=}w3% of the damage done].
  • description:For {$d=15 seconds}, {$?s137012=false}[all single-target healing also damages a nearby enemy target for {$s3=20}% of the healing done][all single-target damage also heals a nearby friendly target for {$s3=20}% of the damage done].
  • max_stacks:0
  • duration:15.00
  • cooldown:90.00
  • default_chance:100.00%
Owlkin Frenzy 2.4 0.1 74.5s 68.3s 7.7s 6.27% 6.96% 0.1 (0.1) 1.3

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_owlkin_frenzy
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.1s / 338.3s
  • trigger_min/max:0.0s / 338.3s
  • trigger_pct:14.99%
  • duration_min/max:0.0s / 33.4s
  • uptime_min/max:0.00% / 26.93%

Stack Uptimes

  • owlkin_frenzy_1:6.27%

Spelldata

  • id:157228
  • name:Owlkin Frenzy
  • tooltip:Your next Starfire is instant cast{$?s354541=false}[ or your next Cyclone or Entangling Roots cast time is reduced by {$s2=0}%.][.]
  • description:{$@spelldesc24858=Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Primordial Arcanic Pulsar 8.1 108.3 38.7s 38.7s 34.7s 94.00% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_primordial_arcanic_pulsar
  • max_stacks:99
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:24.3s / 50.2s
  • trigger_min/max:24.3s / 50.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 47.7s
  • uptime_min/max:90.40% / 96.79%

Stack Uptimes

  • primordial_arcanic_pulsar_4:5.00%
  • primordial_arcanic_pulsar_8:5.51%
  • primordial_arcanic_pulsar_12:6.59%
  • primordial_arcanic_pulsar_16:6.90%
  • primordial_arcanic_pulsar_20:6.49%
  • primordial_arcanic_pulsar_24:6.04%
  • primordial_arcanic_pulsar_28:7.72%
  • primordial_arcanic_pulsar_32:8.07%
  • primordial_arcanic_pulsar_36:6.61%
  • primordial_arcanic_pulsar_40:7.22%
  • primordial_arcanic_pulsar_44:7.02%
  • primordial_arcanic_pulsar_48:7.00%
  • primordial_arcanic_pulsar_52:7.35%
  • primordial_arcanic_pulsar_56:6.49%

Spelldata

  • id:393961
  • name:Primordial Arcanic Pulsar
  • tooltip:{$=}{{$=}w1~} Arcane Power collected by Primordial Arcanic Pulsar.
  • description:{$@spelldesc393960=Every {$s1=600} Astral Power spent grants Celestial Alignment for {$s2=12} sec.}
  • max_stacks:99
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Solstice 18.5 4.0 16.7s 14.1s 6.4s 39.60% 39.84% 4.0 (4.0) 18.1

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_solstice
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:2.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:6.0s / 49.7s
  • trigger_min/max:0.0s / 40.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 17.9s
  • uptime_min/max:36.29% / 42.34%

Stack Uptimes

  • solstice_1:39.60%

Spelldata

  • id:343648
  • name:Solstice
  • tooltip:Shooting Stars fall {$=}w1% more often.
  • description:{$@spelldesc343647=During the first {$343648d=6 seconds} of every Eclipse, Shooting Stars fall {$s1=200}% more often.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Starlord 20.8 94.7 14.7s 2.6s 14.1s 97.26% 0.00% 53.6 (53.6) 7.7

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_starlord
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.0s / 21.1s
  • trigger_min/max:0.8s / 10.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s
  • uptime_min/max:93.95% / 99.15%

Stack Uptimes

  • starlord_1:9.38%
  • starlord_2:15.31%
  • starlord_3:72.58%

Spelldata

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$=}w1%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$s1=2}% Haste for {$279709d=15 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Undulating Sporecloak 6.3 48.3 47.8s 5.5s 43.1s 90.16% 0.00% 54.5 (54.5) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_undulating_sporecloak
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:versatility_rating
  • amount:388.06

Trigger Details

  • interval_min/max:10.0s / 345.0s
  • trigger_min/max:5.0s / 30.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 357.4s
  • uptime_min/max:72.45% / 100.00%

Stack Uptimes

  • undulating_sporecloak_1:90.16%

Spelldata

  • id:410231
  • name:Undulating Sporecloak
  • tooltip:The spores relax, granting {$426944=}w1 versatility and healing you for {$=}w1 every $t sec.
  • description:{$@spelldesc410230=When above {$s2=70}% Health, gain {$s6=51} Versatility and heal for {$s4=1826} every $410231t sec. When your Health is below {$s3=30}% the Symbiotic Spores embedded in your cloak expand, granting a shield that absorbs {$s5=22019} damage for {$410232d=10 seconds}. This effect can only occur once every {$410233d=120 seconds}.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Wafting Devotion 4.3 1.2 61.1s 45.6s 16.5s 23.64% 0.00% 1.2 (1.2) 4.1

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_wafting_devotion
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:haste_rating
  • amount:1743.14
  • stat:speed_rating
  • amount:555.78

Trigger Details

  • interval_min/max:15.0s / 224.8s
  • trigger_min/max:0.0s / 212.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 70.9s
  • uptime_min/max:4.79% / 58.98%

Stack Uptimes

  • wafting_devotion_1:23.64%

Spelldata

  • id:390357
  • name:Wafting Devotion
  • tooltip:Haste increased by {$=}w1 and Speed increased by {$=}w2.
  • description:{$@spelldesc389558=Permanently enchants a weapon to sometimes sway the winds, increasing your Haste by {$=}ec1s1 and Speed by {$=}ec1s2 for {$390357d=15 seconds}. Cannot be applied to items lower than level {$=}ecim.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Warrior of Elune 6.1 0.0 48.4s 48.4s 21.9s 44.59% 43.67% 0.0 (0.0) 2.3

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_warrior_of_elune
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:45.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:45.0s / 82.0s
  • trigger_min/max:45.0s / 82.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s
  • uptime_min/max:32.54% / 51.50%

Stack Uptimes

  • warrior_of_elune_1:21.40%
  • warrior_of_elune_2:4.91%
  • warrior_of_elune_3:18.29%

Spelldata

  • id:202425
  • name:Warrior of Elune
  • tooltip:Starfire is instant cast and generates {$s2=40}% increased Astral Power.
  • description:Your next {$=}n Starfires are instant cast and generate {$s2=40}% increased Astral Power.
  • max_stacks:0
  • duration:25.00
  • cooldown:45.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Draconic Augmentation

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_draconic_augmentation
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:agility
  • amount:86.86
  • stat:strength
  • amount:86.86
  • stat:intellect
  • amount:86.86

Spelldata

  • id:393438
  • name:Draconic Augmentation
  • tooltip:Agility, Intellect and Strength increased by {$=}w1.
  • description:Increases Agility, Intellect and Strength by {$s1=87} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (fated_fortune_cookie)

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_fated_fortune_cookie
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:75.79

Spelldata

  • id:396092
  • name:Well Fed
  • tooltip:Your primary stat is increased by {$=}w1.
  • description:Increases your primary stat by {$s1=76} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Iced Phial of Corrupting Rage

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_iced_phial_of_corrupting_rage
  • max_stacks:1
  • base duration:1800.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:374000
  • name:Iced Phial of Corrupting Rage
  • tooltip:Gain Corrupting Rage which grants {$=}w2 Critical Strike until you have suffered {$s3=400}% of your health, then become afflicted by Overwhelming Rage for {$374037d=15 seconds} before the cycle begins anew.
  • description:Gain Corrupting Rage which grants {$s2=472} Critical Strike rating. After suffering {$s3=400}% of your health in damage, you are afflicted with Overwhelming Rage instead which causes you to take {$=}{{$374037s1=5}*{$374037d=15 seconds}/{$374037t1=3}}% of your health as Nature damage over {$374037d=15 seconds}, after which the cycle begins anew. {$@spelldesc396962=Lasts {$d=1800 seconds} and through death. Consuming an identical phial will add another {$d=1800 seconds}.}
  • max_stacks:0
  • duration:1800.00
  • cooldown:0.00
  • default_chance:101.00%
Lycara's Teachings (Mastery)

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_lycaras_teachings_mast
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:6.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:378992
  • name:Lycara's Teachings
  • tooltip:
  • description:{$@spelldesc378988=You gain {$s1=2}% of a stat while in each form: No Form: Haste Cat Form: Critical Strike Bear Form: Versatility Moonkin Form: Mastery}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Moonkin Form

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.{$?=}{$=}w3>0[ Armor increased by {$=}w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by {$m3=125}%, and granting protection from Polymorph effects.{$?a231042=true}[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Starfire instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Light, Falling Night - Night

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_rising_light_falling_night__night
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:417715
  • name:Rising Light, Falling Night - Night
  • tooltip:Versatility increased by {$s1=2}%.
  • description:Increases your Versatility by {$s1=2}% during the night.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Windfury Totem

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.10
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a totem at your feet for {$d=120 seconds}. Party members within {$?s382201=false}[{$=}{(1+{$382201s3=15}/100)*{$s2=30}}][{$s2=30}] yds have a {$327942h=20}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:20.00%

Procs, Uptimes & Benefits

Proc Count Min Max Interval Min Max
Denizen of the Dream 8.6 2.0 20.0 31.9s 0.0s 142.8s
Primordial Arcanic Pulsar 7.2 6.0 9.0 40.5s 29.3s 50.6s
Uptime Avg % Min Max Avg Dur Min Max
Astral Power Cap 0.08% 0.00% 1.72% 0.5s 0.0s 3.4s
Astral Smolder 78.07% 57.11% 93.09% 14.9s 0.0s 120.0s
Incarnation (Total) 48.41% 43.34% 55.00% 20.3s 0.0s 54.0s
Incarnation (Pulsar) 28.16% 25.93% 30.54% 11.8s 0.0s 12.0s
Lunar Eclipse Only 0.92% 0.72% 1.13% 2.7s 2.6s 2.7s
Solar Eclipse Only 44.39% 36.12% 50.87% 10.8s 0.0s 15.0s
No Eclipse 6.26% 3.62% 8.45% 1.5s 0.0s 3.7s
Friend of the Fae 43.57% 13.72% 82.74% 25.0s 0.0s 139.8s

Cooldown Waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Warrior of Elune7.1430.00037.02443.90226.24570.502
Full Moon
New Moon
Half Moon
0.3450.00022.5215.8645.34128.201

Eclipse Utilization

NoneSolarLunarBoth
Wrath5.174.5%56.7049.8%0.000.0%52.0745.7%
Starfire25.1092.6%0.000.0%2.007.4%0.000.0%
Starsurge0.000.0%46.4740.2%0.000.0%68.9959.8%
New Moon0.040.7%0.203.4%0.000.0%5.7796.0%
Half Moon0.000.0%0.346.0%0.000.0%5.3494.0%
Full Moon0.221.9%3.1527.2%0.080.7%8.1670.3%

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
470 T31_4p
Nature's BalanceAstral Power99.52198.945.47%2.000.110.06%
Full MoonAstral Power5.30264.547.27%49.940.310.12%
Half MoonAstral Power5.68136.383.75%24.000.000.00%
MoonfireAstral Power14.3586.022.36%5.990.070.08%
New MoonAstral Power6.0172.131.98%12.000.000.00%
Orbit BreakerAstral Power6.32188.485.18%29.831.060.56%
Shooting Stars (Moonfire)Astral Power94.66189.125.20%2.000.210.11%
Shooting Stars (Sunfire)Astral Power94.96189.715.21%2.000.200.11%
StarfireAstral Power27.10397.9610.93%14.682.770.69%
SunfireAstral Power17.40104.392.87%6.000.010.01%
WrathAstral Power115.951812.1549.79%15.630.000.00%
Usage Type Count Total Tot% Avg RPE APR
470 T31_4p
StarsurgeAstral Power 115.623650.80100.00%31.5731.627243.53
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Health 734600.0 3295.03 3883.85 1525374.3 557914.2 -649533.8 734600.0
Astral Power 70.0 12.13 12.15 4.7 24.2 0.0 100.0

Statistics & Data Analysis

Fight Length
470 T31_4p Fight Length
Count 22356
Mean 300.07
Minimum 240.02
Maximum 360.00
Spread ( max - min ) 119.98
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 34.6474
5th Percentile 246.28
95th Percentile 354.18
( 95th Percentile - 5th Percentile ) 107.91
Mean Distribution
Standard Deviation 0.2317
95.00% Confidence Interval ( 299.62 - 300.52 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51215
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1025
DPS
470 T31_4p Damage Per Second
Count 22356
Mean 202580.40
Minimum 176283.63
Maximum 237688.92
Spread ( max - min ) 61405.29
Range [ ( max - min ) / 2 * 100% ] 15.16%
Standard Deviation 7718.6901
5th Percentile 190505.58
95th Percentile 215814.46
( 95th Percentile - 5th Percentile ) 25308.88
Mean Distribution
Standard Deviation 51.6234
95.00% Confidence Interval ( 202479.22 - 202681.58 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5577
0.1 Scale Factor Error with Delta=300 508594
0.05 Scale Factor Error with Delta=300 2034375
0.01 Scale Factor Error with Delta=300 50859359
Priority Target DPS
470 T31_4p Priority Target Damage Per Second
Count 22356
Mean 202580.40
Minimum 176283.63
Maximum 237688.92
Spread ( max - min ) 61405.29
Range [ ( max - min ) / 2 * 100% ] 15.16%
Standard Deviation 7718.6901
5th Percentile 190505.58
95th Percentile 215814.46
( 95th Percentile - 5th Percentile ) 25308.88
Mean Distribution
Standard Deviation 51.6234
95.00% Confidence Interval ( 202479.22 - 202681.58 )
Normalized 95.00% Confidence Interval ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5577
0.1 Scale Factor Error with Delta=300 508594
0.05 Scale Factor Error with Delta=300 2034375
0.01 Scale Factor Error with Delta=300 50859359
DPS(e)
470 T31_4p Damage Per Second (Effective)
Count 22356
Mean 202580.40
Minimum 176283.63
Maximum 237688.92
Spread ( max - min ) 61405.29
Range [ ( max - min ) / 2 * 100% ] 15.16%
Damage
470 T31_4p Damage
Count 22356
Mean 58739351.55
Minimum 42587516.66
Maximum 74239889.67
Spread ( max - min ) 31652373.01
Range [ ( max - min ) / 2 * 100% ] 26.94%
DTPS
470 T31_4p Damage Taken Per Second
Count 22356
Mean 3884.17
Minimum 842.97
Maximum 8273.98
Spread ( max - min ) 7431.01
Range [ ( max - min ) / 2 * 100% ] 95.66%
HPS
470 T31_4p Healing Per Second
Count 22356
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
470 T31_4p Healing Per Second (Effective)
Count 22356
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
470 T31_4p Heal
Count 22356
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
470 T31_4p Healing Taken Per Second
Count 22356
Mean 3285.29
Minimum 645.28
Maximum 6767.82
Spread ( max - min ) 6122.53
Range [ ( max - min ) / 2 * 100% ] 93.18%
TMI
470 T31_4p Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
470 T31_4pTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
470 T31_4p Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
5 0.00 variable,name=on_use_trinket,value=0
6 0.00 variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
7 0.00 variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
8 0.00 moonkin_form
9 0.00 wrath
A 0.00 wrath
B 0.00 stellar_flare
C 0.00 starfire,if=!talent.stellar_flare
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
0.00 variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
0.00 berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
D 1.47 potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
0.00 use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
E 3.58 use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
0.00 use_items
F 3.74 natures_vigil
0.00 invoke_external_buff,name=power_infusion
G 0.00 run_action_list,name=aoe,if=variable.is_aoe
H 0.00 run_action_list,name=st
actions.st
# count action,conditions
J 1.50 sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
K 1.25 moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
0.00 starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
0.00 starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
L 1.00 starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
M 0.00 wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
0.00 celestial_alignment,if=variable.cd_condition_st
N 2.00 incarnation,if=variable.cd_condition_st
0.00 variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
0.00 variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
O 6.13 warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
P 25.16 starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
0.00 wrath,if=variable.enter_eclipse
0.00 variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
0.00 starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
0.00 convoke_the_spirits,if=variable.convoke_condition
0.00 astral_communion,if=astral_power.deficit>variable.passive_asp+55
0.00 force_of_nature,if=astral_power.deficit>variable.passive_asp+20
0.00 fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
0.00 starfall,if=buff.starweavers_warp.up
0.00 variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
0.00 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
Q 84.10 starsurge,if=variable.starsurge_condition1
R 15.90 sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
S 13.10 moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
0.00 stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
T 6.03 new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
U 5.71 half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
V 5.36 full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
0.00 variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
W 12.10 cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
X 31.36 starsurge,if=variable.starsurge_condition2
Y 114.25 wrath
Z 0.00 run_action_list,name=fallthru

Sample Sequence

012456789ACFJKLNDEQQQTQUQVYXYXRXYXYSYQQQYYYYXYYOXTYXQYRYWQQQYYYYYXSYXXYYPPWQQRYQYYYXYYXPPQSQYYQQRUQOQVYWQQYPPQQSYRQYYYFYQQYYPPQYQYQRYSWQYQETQUQYQYYOYXYPPQQJYQSYYYYXXYYPPQQRYQYYYXYSXXVQQQRTYYXYPOPQYYWQQYSQYYRYXYPPFWQQNUQYQVQQQYSRYWQQYQYEYYYXYXTYXYYWQQQRYSYYOXYYXXYWQPPQUQRQYQYYXSWQPPQYQYYQRYYYYWQQPPQYSQYYQYROYYQQVFQQTYQYYXYXPPQRKQYQYYYYXXPPQYQRYSQYYYYXOYWQEUDQQVQRXYXYXPPSQQYYQYYTYXRXPPQY

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 flask 470 T31_4p 50.0/100: 50% astral_power
Pre precombat 1 food 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 2 augmentation 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 4 no_cd_talent 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 5 on_use_trinket 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 6 on_use_trinket 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 7 on_use_trinket 470 T31_4p 50.0/100: 50% astral_power corrupting_rage
Pre precombat 8 moonkin_form Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat 9 wrath Fluffy_Pillow 50.0/100: 50% astral_power corrupting_rage
Pre precombat A wrath Fluffy_Pillow 60.0/100: 60% astral_power corrupting_rage
Pre precombat C starfire Fluffy_Pillow 70.0/100: 70% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, corrupting_rage
0:00.000 default F natures_vigil 470 T31_4p 50.0/100: 50% astral_power balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.000 st J sunfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:00.937 st K moonfire Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), eclipse_lunar, solstice, dreamstate, undulating_sporecloak, corrupting_rage
0:01.873 st L starfire Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.717 st N incarnation_chosen_of_elune Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), eclipse_lunar, solstice, undulating_sporecloak, corrupting_rage
0:02.717 default D potion Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage
0:02.717 default E use_items Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:02.717 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:03.569 st Q starsurge Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(100)
0:04.387 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(95)
0:05.177 st T new_moon Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(90)
0:05.932 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:06.694 st U half_moon Fluffy_Pillow 8.0/100: 8% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(85)
0:07.709 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(80)
0:08.469 st V full_moon Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate(2), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
0:09.988 st Y wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
0:10.742 st X starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), dreamstate, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:11.503 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
0:12.257 st X starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
0:13.019 st R sunfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
0:13.779 st X starsurge Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:14.540 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, natures_vigil, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
0:15.302 st X starsurge Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
0:16.063 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
0:16.823 st S moonfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:17.584 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
0:18.346 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(25)
0:19.200 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
0:20.019 st Q starsurge Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
0:20.809 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:21.571 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
0:22.332 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
0:23.094 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:23.854 st X starsurge Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:24.617 st Y wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:25.380 st Y wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.142 st O warrior_of_elune Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.142 st X starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:26.904 st T new_moon Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:27.660 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:28.422 st X starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.183 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:29.947 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:30.708 st R sunfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:31.470 st Y wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.233 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:32.233 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power bloodlust, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(4), solstice, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
0:33.087 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(8), solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:33.907 st Q starsurge Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(12), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:34.694 st Y wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:35.457 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:36.217 st Y wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:36.978 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:37.740 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:38.500 st X starsurge Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:39.262 st S moonfire Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:40.025 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:41.015 st X starsurge Fluffy_Pillow 82.0/100: 82% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(3), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:42.005 st X starsurge Fluffy_Pillow 56.0/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:42.992 st Y wrath Fluffy_Pillow 30.0/100: 30% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:43.980 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), undulating_sporecloak, corrupting_rage
0:44.968 st P starfire Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(3), dreamstate, undulating_sporecloak, corrupting_rage
0:45.723 st P starfire Fluffy_Pillow 74.8/100: 75% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune(2), corrupting_rage
0:46.477 st W cancel_buff Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, corrupting_rage
0:46.477 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, warrior_of_elune, corrupting_rage
0:47.583 st Q starsurge Fluffy_Pillow 59.6/100: 60% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, corrupting_rage
0:48.647 st R sunfire Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), corrupting_rage
0:49.672 st Y wrath Fluffy_Pillow 35.6/100: 36% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), corrupting_rage
0:50.695 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), undulating_sporecloak, corrupting_rage
0:51.720 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), solstice, starlord(3), balance_t31_4pc_buff_solar(3), undulating_sporecloak, corrupting_rage
0:52.807 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:53.892 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:54.981 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
0:56.068 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, corrupting_rage
0:57.154 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, corrupting_rage
0:58.242 st X starsurge Fluffy_Pillow 73.6/100: 74% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, corrupting_rage
0:59.328 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage
1:00.957 st P starfire Fluffy_Pillow 53.6/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(48), starlord(3), dreamstate, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:01.847 st Q starsurge Fluffy_Pillow 65.6/100: 66% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, dreamstate, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:02.953 st S moonfire Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:04.017 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(52), solstice, starlord, balance_t31_4pc_buff_solar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:05.080 st Y wrath Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:05.833 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:06.858 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(56), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:07.985 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:08.972 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:09.961 st U half_moon Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:11.278 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:12.267 st O warrior_of_elune Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:12.267 st Q starsurge Fluffy_Pillow 29.6/100: 30% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:13.256 st V full_moon Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:15.230 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:16.218 st W cancel_buff Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:16.218 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:17.323 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:18.388 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:19.412 st P starfire Fluffy_Pillow 33.6/100: 34% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:20.165 st P starfire Fluffy_Pillow 54.4/100: 54% astral_power natures_grace, primordial_arcanic_pulsar(20), starlord(2), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:20.920 st Q starsurge Fluffy_Pillow 71.2/100: 71% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(2), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:21.944 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:22.931 st S moonfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:23.919 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:24.907 st R sunfire Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:25.993 st Q starsurge Fluffy_Pillow 39.2/100: 39% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:27.080 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:28.168 st Y wrath Fluffy_Pillow 21.2/100: 21% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:29.253 st Y wrath Fluffy_Pillow 37.2/100: 37% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.340 default F natures_vigil 470 T31_4p 55.2/100: 55% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:30.340 st Y wrath Fluffy_Pillow 55.2/100: 55% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:31.427 st Q starsurge Fluffy_Pillow 73.2/100: 73% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:32.644 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:33.814 st Y wrath Fluffy_Pillow 3.2/100: 3% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:34.940 st Y wrath Fluffy_Pillow 19.2/100: 19% astral_power natures_vigil, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.065 st P starfire Fluffy_Pillow 33.2/100: 33% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:36.820 st P starfire Fluffy_Pillow 50.0/100: 50% astral_power natures_vigil, denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:37.744 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:38.768 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:39.757 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power natures_vigil, balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:40.745 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:41.733 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:42.819 st R sunfire Fluffy_Pillow 8.0/100: 8% astral_power natures_vigil, balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:43.906 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power natures_vigil, balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:44.992 st S moonfire Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:46.078 st W cancel_buff Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:46.078 st Q starsurge Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:47.294 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:48.465 st Q starsurge Fluffy_Pillow 58.0/100: 58% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:49.636 default E use_items Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
1:49.636 st T new_moon Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:50.391 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(100)
1:51.417 st U half_moon Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(95)
1:52.734 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(85)
1:53.722 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(80)
1:54.711 st Q starsurge Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(75)
1:55.700 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(70)
1:56.688 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(65)
1:57.677 st O warrior_of_elune Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:57.677 st Y wrath Fluffy_Pillow 42.0/100: 42% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(60)
1:58.666 st X starsurge Fluffy_Pillow 58.0/100: 58% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(55)
1:59.655 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(50)
2:00.645 st P starfire Fluffy_Pillow 44.0/100: 44% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
2:01.401 st P starfire Fluffy_Pillow 60.8/100: 61% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(16), warrior_of_elune(2), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(45)
2:02.155 st Q starsurge Fluffy_Pillow 79.6/100: 80% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(16), solstice, warrior_of_elune, best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(40)
2:03.262 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(35)
2:04.326 st J sunfire Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn, best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(30)
2:05.351 st Y wrath Fluffy_Pillow 25.6/100: 26% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(25)
2:06.376 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(20)
2:07.401 st S moonfire Fluffy_Pillow 11.6/100: 12% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(15)
2:08.487 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature, denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(10)
2:09.575 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power denizen_of_the_dream(3), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, corrupting_rage, kindled_soul(5)
2:10.662 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:11.747 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:12.832 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:13.918 st X starsurge Fluffy_Pillow 53.6/100: 54% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:15.004 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:16.091 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, owlkin_frenzy, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:17.178 st P starfire Fluffy_Pillow 47.6/100: 48% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, owlkin_frenzy, primordial_arcanic_pulsar(36), warrior_of_elune, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:17.933 st P starfire Fluffy_Pillow 64.4/100: 64% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:18.686 st Q starsurge Fluffy_Pillow 83.2/100: 83% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:19.791 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:20.855 st R sunfire Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:21.878 st Y wrath Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:22.902 st Q starsurge Fluffy_Pillow 47.2/100: 47% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_urctos(7), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:24.028 st Y wrath Fluffy_Pillow 15.2/100: 15% astral_power balance_of_all_things_nature(2), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(6), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:25.115 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
2:26.202 st Y wrath Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:27.207 st X starsurge Fluffy_Pillow 67.2/100: 67% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:28.214 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:29.220 st S moonfire Fluffy_Pillow 81.2/100: 81% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:30.226 st X starsurge Fluffy_Pillow 89.2/100: 89% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:31.232 st X starsurge Fluffy_Pillow 53.2/100: 53% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:32.237 st V full_moon Fluffy_Pillow 19.2/100: 19% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:34.062 st Q starsurge Fluffy_Pillow 77.2/100: 77% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:35.086 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:36.071 st Q starsurge Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.019 st R sunfire Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:37.934 st T new_moon Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:38.688 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:39.604 st Y wrath Fluffy_Pillow 41.2/100: 41% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:40.517 st X starsurge Fluffy_Pillow 57.2/100: 57% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:41.431 st Y wrath Fluffy_Pillow 33.2/100: 33% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:42.347 st P starfire Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.716 st O warrior_of_elune Fluffy_Pillow 65.2/100: 65% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:43.716 st P starfire Fluffy_Pillow 65.2/100: 65% astral_power natures_grace, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
2:44.471 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(16), solstice, starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:45.458 st Y wrath Fluffy_Pillow 50.0/100: 50% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:46.212 st Y wrath Fluffy_Pillow 66.0/100: 66% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.200 st W cancel_buff Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:47.200 st Q starsurge Fluffy_Pillow 82.0/100: 82% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune(2), balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:48.308 st Q starsurge Fluffy_Pillow 52.0/100: 52% astral_power balance_of_all_things_nature(4), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:49.373 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:50.499 st S moonfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:51.625 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune(2), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:52.751 st Y wrath Fluffy_Pillow 6.0/100: 6% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:53.836 st Y wrath Fluffy_Pillow 22.0/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:54.923 st R sunfire Fluffy_Pillow 40.0/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
2:56.009 st Y wrath Fluffy_Pillow 46.0/100: 46% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:57.094 st X starsurge Fluffy_Pillow 64.0/100: 64% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak
2:58.179 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak
2:59.265 st P starfire Fluffy_Pillow 38.0/100: 38% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:00.020 st P starfire Fluffy_Pillow 58.8/100: 59% astral_power natures_grace, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak
3:00.774 default F natures_vigil 470 T31_4p 77.6/100: 78% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:00.774 st W cancel_buff Fluffy_Pillow 77.6/100: 78% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, starlord(3), best_friends_with_aerwynn_static, undulating_sporecloak
3:00.774 st Q starsurge Fluffy_Pillow 77.6/100: 78% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(36), solstice, best_friends_with_aerwynn_static, undulating_sporecloak
3:01.881 st Q starsurge Fluffy_Pillow 43.6/100: 44% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak
3:02.945 st N incarnation_chosen_of_elune Fluffy_Pillow 11.6/100: 12% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:02.945 st U half_moon Fluffy_Pillow 11.6/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:04.185 st Q starsurge Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(2), dreamstate(2), best_friends_with_aerwynn_static, undulating_sporecloak
3:05.118 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:05.872 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:06.860 st V full_moon Fluffy_Pillow 9.6/100: 10% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:08.833 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(52), solstice, starlord(3), balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:09.821 st Q starsurge Fluffy_Pillow 71.6/100: 72% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak
3:10.808 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_arcane(8), balance_of_all_things_nature(8), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, solstice, starlord(3), balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
3:11.723 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power natures_vigil, balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:12.478 st S moonfire Fluffy_Pillow 41.6/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:13.393 st R sunfire Fluffy_Pillow 49.6/100: 50% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:14.306 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:15.218 st W cancel_buff Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:15.218 st Q starsurge Fluffy_Pillow 75.6/100: 76% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:16.240 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:17.225 st Y wrath Fluffy_Pillow 21.6/100: 22% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:18.172 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(12), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:19.119 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.036 default E use_items Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
3:20.036 st Y wrath Fluffy_Pillow 29.6/100: 30% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:20.951 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(100)
3:21.864 st Y wrath Fluffy_Pillow 67.6/100: 68% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(95)
3:22.778 st X starsurge Fluffy_Pillow 83.6/100: 84% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(16), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(90)
3:23.690 st Y wrath Fluffy_Pillow 57.6/100: 58% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(85)
3:24.605 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(20), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(80)
3:25.520 st T new_moon Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(75)
3:26.437 st Y wrath Fluffy_Pillow 59.6/100: 60% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(70)
3:27.350 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, owlkin_frenzy, primordial_arcanic_pulsar(24), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(65)
3:28.265 st Y wrath Fluffy_Pillow 51.6/100: 52% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(60)
3:29.180 st Y wrath Fluffy_Pillow 69.6/100: 70% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(55)
3:30.095 st W cancel_buff Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
3:30.095 st Q starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(28), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, kindled_soul(50)
3:31.120 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(32), starlord, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(45)
3:32.186 st Q starsurge Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(36), starlord(2), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(40)
3:33.212 st R sunfire Fluffy_Pillow 11.6/100: 12% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(35)
3:34.200 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(30)
3:35.189 st S moonfire Fluffy_Pillow 35.6/100: 36% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(25)
3:36.178 st Y wrath Fluffy_Pillow 45.6/100: 46% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(20)
3:37.167 st Y wrath Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(15)
3:38.154 st O warrior_of_elune Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:38.154 st X starsurge Fluffy_Pillow 79.6/100: 80% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(10)
3:39.142 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, kindled_soul(5)
3:40.130 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:41.119 st X starsurge Fluffy_Pillow 87.6/100: 88% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(44), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(11), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:42.108 st X starsurge Fluffy_Pillow 61.6/100: 62% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(10), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:43.098 st Y wrath Fluffy_Pillow 33.6/100: 34% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(9), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.086 st W cancel_buff Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:44.086 st Q starsurge Fluffy_Pillow 49.6/100: 50% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos(8), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:45.194 st P starfire Fluffy_Pillow 25.6/100: 26% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord, warrior_of_elune(3), dreamstate, best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:45.948 st P starfire Fluffy_Pillow 42.4/100: 42% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), starlord, warrior_of_elune(2), best_friends_with_urctos(6), best_friends_with_urctos_static, corrupting_rage
3:46.701 st Q starsurge Fluffy_Pillow 61.2/100: 61% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(56), solstice, starlord, warrior_of_elune, best_friends_with_urctos(5), best_friends_with_urctos_static, corrupting_rage
3:47.767 st U half_moon Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(4), best_friends_with_urctos_static, corrupting_rage
3:49.009 st Q starsurge Fluffy_Pillow 55.2/100: 55% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar, balance_t31_4pc_buff_lunar, best_friends_with_urctos(3), best_friends_with_urctos_static, corrupting_rage
3:49.940 st R sunfire Fluffy_Pillow 27.2/100: 27% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos(2), best_friends_with_urctos_static, corrupting_rage
3:50.839 st Q starsurge Fluffy_Pillow 37.2/100: 37% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(2), balance_t31_4pc_buff_lunar(2), best_friends_with_urctos, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:51.738 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:52.726 st Q starsurge Fluffy_Pillow 33.2/100: 33% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), balance_t31_4pc_buff_lunar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:53.714 st Y wrath Fluffy_Pillow 5.2/100: 5% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:54.703 st Y wrath Fluffy_Pillow 23.2/100: 23% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
3:55.691 st X starsurge Fluffy_Pillow 39.2/100: 39% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(4), balance_t31_4pc_buff_lunar(4), best_friends_with_urctos_static, corrupting_rage
3:56.679 st S moonfire Fluffy_Pillow 11.2/100: 11% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:57.667 st W cancel_buff Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:57.667 st Q starsurge Fluffy_Pillow 51.2/100: 51% astral_power incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), warrior_of_elune, balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_urctos_static, corrupting_rage
3:58.774 st P starfire Fluffy_Pillow 25.2/100: 25% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord, warrior_of_elune, dreamstate, best_friends_with_urctos_static, corrupting_rage
3:59.527 st P starfire Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(20), starlord, best_friends_with_urctos_static, corrupting_rage
4:00.487 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, starlord, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:01.553 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:02.578 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(2), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:03.603 st Y wrath Fluffy_Pillow 10.0/100: 10% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:04.591 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power balance_of_all_things_nature(4), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:05.580 st Q starsurge Fluffy_Pillow 44.0/100: 44% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(28), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:06.667 st R sunfire Fluffy_Pillow 12.0/100: 12% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:07.754 st Y wrath Fluffy_Pillow 20.0/100: 20% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:08.839 st Y wrath Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:09.923 st Y wrath Fluffy_Pillow 54.0/100: 54% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:11.009 st Y wrath Fluffy_Pillow 70.0/100: 70% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:12.094 st W cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:12.094 st Q starsurge Fluffy_Pillow 90.0/100: 90% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:13.309 st Q starsurge Fluffy_Pillow 56.0/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord, balance_t31_4pc_buff_solar(4), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:14.479 st P starfire Fluffy_Pillow 20.0/100: 20% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(40), starlord(2), balance_t31_4pc_buff_solar(5), best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:16.167 st P starfire Fluffy_Pillow 36.0/100: 36% astral_power denizen_of_the_dream, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:17.090 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(40), solstice, starlord(2), dreamstate, best_friends_with_urctos_static, undulating_sporecloak, corrupting_rage
4:18.115 st Y wrath Fluffy_Pillow 18.0/100: 18% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:18.869 st S moonfire Fluffy_Pillow 34.0/100: 34% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:19.782 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power balance_of_all_things_nature(6), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord(3), balance_t31_4pc_buff_solar, best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:20.696 st Y wrath Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_nature(5), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:21.610 st Y wrath Fluffy_Pillow 28.0/100: 28% astral_power balance_of_all_things_nature(4), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:22.615 st Q starsurge Fluffy_Pillow 48.0/100: 48% astral_power balance_of_all_things_nature(3), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(48), solstice, starlord(3), balance_t31_4pc_buff_solar(2), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:23.620 st Y wrath Fluffy_Pillow 14.0/100: 14% astral_power balance_of_all_things_nature(2), denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_urctos_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:24.626 st R sunfire Fluffy_Pillow 32.0/100: 32% astral_power balance_of_all_things_nature, denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(11), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.631 st O warrior_of_elune Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:25.631 st Y wrath Fluffy_Pillow 40.0/100: 40% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(10), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:26.634 st Y wrath Fluffy_Pillow 58.0/100: 58% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(9), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:27.640 st Q starsurge Fluffy_Pillow 78.0/100: 78% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(52), warrior_of_elune(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn(8), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:28.768 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(56), starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn(7), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:29.851 st V full_moon Fluffy_Pillow 8.0/100: 8% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(6), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.741 default F natures_vigil 470 T31_4p 64.0/100: 64% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:31.741 st Q starsurge Fluffy_Pillow 64.0/100: 64% astral_power natures_vigil, balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:32.688 st Q starsurge Fluffy_Pillow 38.0/100: 38% astral_power natures_vigil, balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(4), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage
4:33.603 st T new_moon Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:34.359 st Y wrath Fluffy_Pillow 26.0/100: 26% astral_power natures_vigil, balance_of_all_things_arcane(3), balance_of_all_things_nature(3), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:35.347 st Q starsurge Fluffy_Pillow 42.0/100: 42% astral_power natures_vigil, balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:36.335 st Y wrath Fluffy_Pillow 16.0/100: 16% astral_power natures_vigil, balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:37.323 st Y wrath Fluffy_Pillow 32.0/100: 32% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:38.311 st X starsurge Fluffy_Pillow 48.0/100: 48% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:39.299 st Y wrath Fluffy_Pillow 24.0/100: 24% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:40.289 st X starsurge Fluffy_Pillow 40.0/100: 40% astral_power natures_vigil, incarnation_chosen_of_elune, eclipse_lunar, eclipse_solar, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:41.279 st P starfire Fluffy_Pillow 12.0/100: 12% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:42.033 st P starfire Fluffy_Pillow 30.8/100: 31% astral_power natures_vigil, natures_grace, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:42.788 st Q starsurge Fluffy_Pillow 47.6/100: 48% astral_power natures_vigil, balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(20), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:43.896 st R sunfire Fluffy_Pillow 13.6/100: 14% astral_power natures_vigil, balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:44.959 st K moonfire Fluffy_Pillow 51.6/100: 52% astral_power natures_vigil, balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:46.023 st Q starsurge Fluffy_Pillow 63.6/100: 64% astral_power natures_vigil, balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:47.088 st Y wrath Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_nature(3), eclipse_solar, primordial_arcanic_pulsar(28), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:48.215 st Q starsurge Fluffy_Pillow 53.6/100: 54% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(28), starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:49.341 st Y wrath Fluffy_Pillow 19.6/100: 20% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:50.428 st Y wrath Fluffy_Pillow 37.6/100: 38% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:51.514 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:52.600 st Y wrath Fluffy_Pillow 71.6/100: 72% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:53.687 st X starsurge Fluffy_Pillow 89.6/100: 90% astral_power eclipse_solar, primordial_arcanic_pulsar(32), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:54.772 st X starsurge Fluffy_Pillow 57.6/100: 58% astral_power eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:55.860 st P starfire Fluffy_Pillow 21.6/100: 22% astral_power eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:57.489 st P starfire Fluffy_Pillow 39.6/100: 40% astral_power natures_grace, primordial_arcanic_pulsar(40), starlord(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:58.378 st Q starsurge Fluffy_Pillow 51.6/100: 52% astral_power balance_of_all_things_nature(8), eclipse_solar, natures_grace, primordial_arcanic_pulsar(40), solstice, dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
4:59.484 st Y wrath Fluffy_Pillow 17.6/100: 18% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:00.236 st Q starsurge Fluffy_Pillow 37.6/100: 38% astral_power balance_of_all_things_nature(7), eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:01.301 st R sunfire Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature(6), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:02.325 st Y wrath Fluffy_Pillow 13.6/100: 14% astral_power balance_of_all_things_nature(5), eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage
5:03.349 st S moonfire Fluffy_Pillow 33.6/100: 34% astral_power balance_of_all_things_nature(4), eclipse_solar, primordial_arcanic_pulsar(48), solstice, starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
5:04.475 st Q starsurge Fluffy_Pillow 39.6/100: 40% astral_power balance_of_all_things_nature(2), eclipse_solar, primordial_arcanic_pulsar(48), starlord(2), balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak
5:05.602 st Y wrath Fluffy_Pillow 3.6/100: 4% astral_power balance_of_all_things_nature, eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
5:06.689 st Y wrath Fluffy_Pillow 23.6/100: 24% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
5:07.775 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power eclipse_solar, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
5:08.862 st Y wrath Fluffy_Pillow 55.6/100: 56% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
5:09.947 st X starsurge Fluffy_Pillow 75.6/100: 76% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(52), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_aerwynn_static, undulating_sporecloak
5:11.033 st O warrior_of_elune Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
5:11.033 st Y wrath Fluffy_Pillow 41.6/100: 42% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
5:12.037 st W cancel_buff Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
5:12.037 st Q starsurge Fluffy_Pillow 61.6/100: 62% astral_power denizen_of_the_dream, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(56), warrior_of_elune(3), balance_t31_4pc_buff_solar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
5:13.161 default E use_items Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion
5:13.161 st U half_moon Fluffy_Pillow 27.6/100: 28% astral_power balance_of_all_things_arcane(7), balance_of_all_things_nature(7), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(100)
5:14.472 default D potion Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, kindled_soul(95)
5:14.472 st Q starsurge Fluffy_Pillow 57.6/100: 58% astral_power balance_of_all_things_arcane(6), balance_of_all_things_nature(6), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, solstice, starlord, warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(95)
5:15.457 st Q starsurge Fluffy_Pillow 31.6/100: 32% astral_power balance_of_all_things_arcane(5), balance_of_all_things_nature(5), incarnation_chosen_of_elune, denizen_of_the_dream, eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(4), solstice, starlord(2), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(90)
5:16.405 st V full_moon Fluffy_Pillow 5.6/100: 6% astral_power balance_of_all_things_arcane(4), balance_of_all_things_nature(4), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), solstice, starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, elemental_potion_of_ultimate_power, kindled_soul(85)
5:18.229 st Q starsurge Fluffy_Pillow 93.6/100: 94% astral_power balance_of_all_things_arcane(2), balance_of_all_things_nature(2), incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(8), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(3), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:19.143 st R sunfire Fluffy_Pillow 67.6/100: 68% astral_power balance_of_all_things_arcane, balance_of_all_things_nature, incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(75)
5:20.058 st X starsurge Fluffy_Pillow 73.6/100: 74% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(12), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(4), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(70)
5:20.971 st Y wrath Fluffy_Pillow 47.6/100: 48% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(65)
5:21.885 st X starsurge Fluffy_Pillow 65.6/100: 66% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(16), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(60)
5:22.800 st Y wrath Fluffy_Pillow 39.6/100: 40% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(55)
5:23.714 st X starsurge Fluffy_Pillow 55.6/100: 56% astral_power incarnation_chosen_of_elune, denizen_of_the_dream(2), eclipse_lunar, eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(20), starlord(3), warrior_of_elune(3), balance_t31_4pc_buff_solar(5), balance_t31_4pc_buff_lunar(5), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(50)
5:24.625 st P starfire Fluffy_Pillow 31.6/100: 32% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(3), dreamstate, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(45)
5:25.380 st P starfire Fluffy_Pillow 48.4/100: 48% astral_power denizen_of_the_dream(2), friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), starlord(3), warrior_of_elune(2), best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:26.134 st S moonfire Fluffy_Pillow 69.2/100: 69% astral_power balance_of_all_things_nature(8), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, starlord(3), warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, wafting_devotion, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(40)
5:27.049 st Q starsurge Fluffy_Pillow 79.2/100: 79% astral_power balance_of_all_things_nature(7), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(24), solstice, warrior_of_elune, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(35)
5:28.154 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(6), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(28), solstice, starlord, warrior_of_elune, balance_t31_4pc_buff_solar, best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(30)
5:29.220 st Y wrath Fluffy_Pillow 11.2/100: 11% astral_power balance_of_all_things_nature(5), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, natures_grace, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(20)
5:30.244 st Y wrath Fluffy_Pillow 29.2/100: 29% astral_power balance_of_all_things_nature(4), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_aerwynn_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(15)
5:31.371 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(3), denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(32), solstice, starlord(2), warrior_of_elune, balance_t31_4pc_buff_solar(2), best_friends_with_pip(11), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(10)
5:32.499 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature, denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(10), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power, kindled_soul(5)
5:33.584 st Y wrath Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(9), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:34.670 st T new_moon Fluffy_Pillow 47.2/100: 47% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(8), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:35.424 st Y wrath Fluffy_Pillow 59.2/100: 59% astral_power denizen_of_the_dream(2), eclipse_solar, friend_of_the_fae, primordial_arcanic_pulsar(36), starlord(3), warrior_of_elune, balance_t31_4pc_buff_solar(3), best_friends_with_pip(7), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:36.511 st X starsurge Fluffy_Pillow 77.2/100: 77% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(36), starlord(3), balance_t31_4pc_buff_solar(3), best_friends_with_pip(6), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:37.597 st R sunfire Fluffy_Pillow 43.2/100: 43% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(5), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:38.682 st X starsurge Fluffy_Pillow 51.2/100: 51% astral_power denizen_of_the_dream(2), eclipse_solar, primordial_arcanic_pulsar(40), starlord(3), balance_t31_4pc_buff_solar(4), best_friends_with_pip(4), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:39.769 st P starfire Fluffy_Pillow 19.2/100: 19% astral_power denizen_of_the_dream, eclipse_solar, primordial_arcanic_pulsar(44), starlord(3), balance_t31_4pc_buff_solar(5), best_friends_with_pip(3), best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:41.397 st P starfire Fluffy_Pillow 31.2/100: 31% astral_power denizen_of_the_dream, natures_grace, primordial_arcanic_pulsar(44), starlord(3), dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:42.286 st Q starsurge Fluffy_Pillow 45.2/100: 45% astral_power balance_of_all_things_nature(8), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(44), solstice, dreamstate, best_friends_with_pip, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power
5:43.392 st Y wrath Fluffy_Pillow 13.2/100: 13% astral_power balance_of_all_things_nature(7), denizen_of_the_dream, eclipse_solar, natures_grace, primordial_arcanic_pulsar(48), solstice, starlord, balance_t31_4pc_buff_solar, best_friends_with_pip_static, undulating_sporecloak, corrupting_rage, elemental_potion_of_ultimate_power

Stats

Level Bonus (70) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 898 -2 982 896 0
Agility 2089 2 2177 2091 0
Stamina 3848 0 36730 34981 31271
Intellect 2089 0 13776 12951 10246 (6349)
Spirit 0 0 0 0 0
Health 734600 734600 0
Mana 250000 250000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13776 12951 0
Crit 27.36% 21.15% 2907
Haste 23.68% 23.68% 3817
Versatility 8.87% 3.87% 793
Mana Regen 2560 2560 0
Attack Power 14327 13469 0
Mastery 27.84% 27.84% 7080
Armor 4652 4652 4652
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 470.00
Local Head Benevolent Embersage's Casque
ilevel: 470, stats: { 585 Armor, +3163 Sta, +655 Crit, +307 Haste, +786 AgiInt }, gems: { +75 StrAgiInt, +66 Mastery }
Local Neck Eye of the Rising Flame
ilevel: 470, stats: { +1779 Sta, +233 Haste, +1397 Mastery }, gems: { +70 Mastery, +33 Haste, +70 Mastery, +33 Haste, +70 Mastery, +33 Haste }
Local Shoulders Benevolent Embersage's Wisdom
ilevel: 470, stats: { 536 Armor, +2372 Sta, +214 Haste, +507 Vers, +590 AgiInt }
Local Chest Benevolent Embersage's Robe
ilevel: 470, stats: { 780 Armor, +3163 Sta, +665 Crit, +296 Mastery, +786 AgiInt }, enchant: { +150 StrAgiInt (waking_stats_3) }
Local Waist Benevolent Embersage's Sagacious Sash
ilevel: 470, stats: { 439 Armor, +2372 Sta, +497 Haste, +224 Mastery, +590 AgiInt }, gems: { +70 Mastery, +33 Haste }, enchant: { +106 Sta (shadowed_belt_clasp_3) }
Local Legs Benevolent Embersage's Leggings
ilevel: 470, stats: { 683 Armor, +3163 Sta, +656 Haste, +305 Mastery, +786 AgiInt }, enchant: { +177 Int, +131 Sta (frozen_spellthread_3) }
Local Feet Toxic Thorn Footwraps
ilevel: 470, stats: { 488 Armor, +2372 Sta, +257 Crit, +412 Haste, +590 AgiInt }
item effects: { equip: Thriving Thorns, equip: Thriving Thorns }
Local Wrists Bracers of Dreadful Maladies
ilevel: 470, stats: { 390 Armor, +1779 Sta, +212 Crit, +328 Mastery, +442 AgiInt }, gems: { +70 Mastery, +33 Haste }
Local Hands Fading Chronogrips
ilevel: 470, stats: { 439 Armor, +2372 Sta, +330 Haste, +391 Mastery, +590 AgiInt }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 470, stats: { +1779 Sta, +466 Haste, +1165 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Finger2 Band of Twisted Bark
ilevel: 470, stats: { +1779 Sta, +1118 Crit, +512 Mastery }, gems: { +70 Mastery, +33 Haste }, enchant: { +82 Haste (devotion_of_haste_3) }
Local Trinket1 Pip's Emerald Friendship Badge
ilevel: 470, stats: { +747 StrAgiInt }
item effects: { equip: Pip's Emerald Friendship Badge }
Local Trinket2 Balefire Branch
ilevel: 470, stats: { +687 Mastery }
item effects: { use: Balefire Branch }
Local Back Undulating Sporecloak
ilevel: 470, stats: { 312 Armor, +1779 Sta, +286 Vers, +255 Mastery, +442 StrAgiInt }
item effects: { equip: Undulating Sporecloak }
Local Main Hand Vakash, the Shadowed Inferno
ilevel: 470, weapon: { 508 - 654, 2.6 }, stats: { +393 Int, +1896 Int, +1581 Sta, +145 Haste, +335 Mastery }, enchant: wafting_devotion_3, temporary_enchant: Hissing Rune
item effects: { equip: Hungering Shadowflame }
Local Off Hand Trickster's Captivating Chime
ilevel: 470, stats: { +1206 Int, +1581 Sta, +162 Haste, +319 Mastery }

Profile

druid="470 T31_4p"
source=default
spec=balance
level=70
race=night_elf
timeofday=night
role=spell
position=back
talents=BYGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAgCAJJigkQQSikIFolIJSSJRTcgQol0SSERDgCAE

# Default consumables
potion=elemental_potion_of_ultimate_power_3
flask=iced_phial_of_corrupting_rage_3
food=fated_fortune_cookie
augmentation=draconic
temporary_enchant=main_hand:hissing_rune_3

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Balance APL can be found at https://balance-simc.github.io/Balance-SimC/balance.txt

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/variable,name=no_cd_talent,value=!talent.celestial_alignment&!talent.incarnation_chosen_of_elune|druid.no_cds
actions.precombat+=/variable,name=on_use_trinket,value=0
actions.precombat+=/variable,name=on_use_trinket,op=add,value=trinket.1.has_proc.any&trinket.1.cooldown.duration|trinket.1.is.spoils_of_neltharus|trinket.1.is.mirror_of_fractured_tomorrows
actions.precombat+=/variable,name=on_use_trinket,op=add,value=(trinket.2.has_proc.any&trinket.2.cooldown.duration|trinket.2.is.spoils_of_neltharus|trinket.2.is.mirror_of_fractured_tomorrows)*2
actions.precombat+=/moonkin_form
actions.precombat+=/wrath
actions.precombat+=/wrath
actions.precombat+=/stellar_flare
actions.precombat+=/starfire,if=!talent.stellar_flare

# Executed every time the actor is available.
actions=variable,name=is_aoe,value=spell_targets.starfall>(1+(!talent.aetherial_kindling&!talent.starweaver))&talent.starfall
actions+=/variable,name=passive_asp,value=6%spell_haste+talent.natures_balance+talent.orbit_breaker*dot.moonfire.ticking*(buff.orbit_breaker.stack>(27-2*buff.solstice.up))*40
actions+=/berserking,if=buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<15
actions+=/potion,if=!druid.no_cds&(buff.ca_inc.remains>=20|variable.no_cd_talent|fight_remains<30)
actions+=/use_items,slots=trinket1,if=variable.on_use_trinket!=1&!trinket.2.ready_cooldown|(variable.on_use_trinket=1|variable.on_use_trinket=3)&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items,slots=trinket2,if=variable.on_use_trinket!=2&!trinket.1.ready_cooldown|variable.on_use_trinket=2&buff.ca_inc.up|variable.no_cd_talent|fight_remains<20|variable.on_use_trinket=0
actions+=/use_items
actions+=/natures_vigil
actions+=/invoke_external_buff,name=power_infusion
actions+=/run_action_list,name=aoe,if=variable.is_aoe
actions+=/run_action_list,name=st

actions.aoe=moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=fight_style.dungeonroute
actions.aoe+=/variable,name=cd_condition_aoe,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>10&buff.primordial_arcanic_pulsar.value<500|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.aoe+=/sunfire,target_if=refreshable&(target.time_to_die-remains)>6-(spell_targets%2)&astral_power.deficit>variable.passive_asp+3
actions.aoe+=/moonfire,target_if=refreshable&(target.time_to_die-remains)>6&astral_power.deficit>variable.passive_asp+3,if=!fight_style.dungeonroute
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)&variable.cd_condition_aoe
actions.aoe+=/variable,name=starfall_condition1,value=variable.cd_condition_aoe&(talent.orbital_strike&astral_power.deficit<variable.passive_asp+8*spell_targets|buff.touch_the_cosmos.up)|astral_power.deficit<(variable.passive_asp+8+12*(buff.eclipse_lunar.remains<4|buff.eclipse_solar.remains<4))
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition1
actions.aoe+=/starfall,if=variable.starfall_condition1
actions.aoe+=/starfire,if=buff.dreamstate.up&variable.cd_condition_aoe&buff.eclipse_lunar.up
actions.aoe+=/celestial_alignment,if=variable.cd_condition_aoe
actions.aoe+=/incarnation,if=variable.cd_condition_aoe
actions.aoe+=/warrior_of_elune
actions.aoe+=/variable,name=enter_solar,value=spell_targets.starfire<3
actions.aoe+=/starfire,if=variable.enter_solar&(eclipse.any_next|buff.eclipse_solar.remains<action.starfire.cast_time)
actions.aoe+=/wrath,if=!variable.enter_solar&(eclipse.any_next|buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.aoe+=/wild_mushroom,if=astral_power.deficit>variable.passive_asp+20&(!talent.waning_twilight|dot.fungal_growth.remains<2&target.time_to_die>7&!prev_gcd.1.wild_mushroom)
actions.aoe+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.aoe+=/variable,name=starfall_condition2,value=target.time_to_die>4&(buff.starweavers_warp.up|talent.starlord&buff.starlord.stack<3)
actions.aoe+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starfall_condition2
actions.aoe+=/starfall,if=variable.starfall_condition2
actions.aoe+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<3
actions.aoe+=/stellar_flare,target_if=refreshable&(target.time_to_die-remains-spell_targets.starfire)>8+spell_targets.starfire,if=astral_power.deficit>variable.passive_asp+8&spell_targets.starfire<(11-talent.umbral_intensity.rank-talent.astral_smolder.rank)
actions.aoe+=/astral_communion,if=astral_power.deficit>variable.passive_asp+50
actions.aoe+=/convoke_the_spirits,if=astral_power<50&spell_targets.starfall<3+talent.elunes_guidance&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.aoe+=/new_moon,if=astral_power.deficit>variable.passive_asp+10
actions.aoe+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)
actions.aoe+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.aoe+=/starsurge,if=buff.starweavers_weft.up&spell_targets.starfire<17
actions.aoe+=/starfire,if=spell_targets>(3-(buff.dreamstate.up|buff.balance_t31_4pc_buff_lunar.stack>buff.balance_t31_4pc_buff_solar.stack))&buff.eclipse_lunar.up|eclipse.in_lunar
actions.aoe+=/wrath
actions.aoe+=/run_action_list,name=fallthru

actions.fallthru=starfall,if=variable.is_aoe
actions.fallthru+=/starsurge
actions.fallthru+=/sunfire,target_if=dot.moonfire.remains>remains*22%18
actions.fallthru+=/moonfire

actions.st=sunfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/variable,name=cd_condition_st,value=!druid.no_cds&(cooldown.ca_inc.remains<5&!buff.ca_inc.up&(target.time_to_die>15&buff.primordial_arcanic_pulsar.value<480|fight_remains<25+10*talent.incarnation_chosen_of_elune))
actions.st+=/moonfire,target_if=refreshable&remains<2&(target.time_to_die-remains)>6
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8&remains<2&(target.time_to_die-remains)>8
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&(buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up|buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up)
actions.st+=/starfall,if=buff.primordial_arcanic_pulsar.value>=550&!buff.ca_inc.up&buff.starweavers_warp.up
actions.st+=/starsurge,if=buff.primordial_arcanic_pulsar.value>=560&buff.starweavers_weft.up
actions.st+=/starfire,if=buff.dreamstate.up&variable.cd_condition_st&eclipse.in_lunar
actions.st+=/wrath,if=buff.dreamstate.up&variable.cd_condition_st&buff.eclipse_solar.up
actions.st+=/celestial_alignment,if=variable.cd_condition_st
actions.st+=/incarnation,if=variable.cd_condition_st
actions.st+=/variable,name=solar_eclipse_st,value=buff.primordial_arcanic_pulsar.value<520&cooldown.ca_inc.remains>5&spell_targets.starfire<3|set_bonus.tier31_2pc
actions.st+=/variable,name=enter_eclipse,value=eclipse.any_next|variable.solar_eclipse_st&buff.eclipse_solar.up&(buff.eclipse_solar.remains<action.starfire.cast_time)|!variable.solar_eclipse_st&buff.eclipse_lunar.up&(buff.eclipse_lunar.remains<action.wrath.cast_time)
actions.st+=/warrior_of_elune,if=variable.solar_eclipse_st&(variable.enter_eclipse|buff.eclipse_solar.remains<7)
actions.st+=/starfire,if=variable.enter_eclipse&(variable.solar_eclipse_st|buff.warrior_of_elune.up)
actions.st+=/wrath,if=variable.enter_eclipse
actions.st+=/variable,name=convoke_condition,value=buff.ca_inc.remains>4|(cooldown.ca_inc.remains>30|variable.no_cd_talent)&(buff.eclipse_lunar.remains>4|buff.eclipse_solar.remains>4)
actions.st+=/starsurge,if=talent.convoke_the_spirits&cooldown.convoke_the_spirits.ready&variable.convoke_condition
actions.st+=/convoke_the_spirits,if=variable.convoke_condition
actions.st+=/astral_communion,if=astral_power.deficit>variable.passive_asp+55
actions.st+=/force_of_nature,if=astral_power.deficit>variable.passive_asp+20
actions.st+=/fury_of_elune,if=target.time_to_die>2&(buff.ca_inc.remains>3|cooldown.ca_inc.remains>30&buff.primordial_arcanic_pulsar.value<=280|buff.primordial_arcanic_pulsar.value>=560&astral_power>50)|fight_remains<10
actions.st+=/starfall,if=buff.starweavers_warp.up
actions.st+=/variable,name=starsurge_condition1,value=talent.starlord&buff.starlord.stack<3|(buff.balance_of_all_things_arcane.stack+buff.balance_of_all_things_nature.stack)>2&buff.starlord.remains>4
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition1
actions.st+=/starsurge,if=variable.starsurge_condition1
actions.st+=/sunfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/moonfire,target_if=refreshable&astral_power.deficit>variable.passive_asp+3
actions.st+=/stellar_flare,target_if=refreshable&astral_power.deficit>variable.passive_asp+8
actions.st+=/new_moon,if=astral_power.deficit>variable.passive_asp+10&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/half_moon,if=astral_power.deficit>variable.passive_asp+20&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/full_moon,if=astral_power.deficit>variable.passive_asp+40&(buff.eclipse_lunar.remains>execute_time|buff.eclipse_solar.remains>execute_time)&(buff.ca_inc.up|charges_fractional>2.5&buff.primordial_arcanic_pulsar.value<=520&cooldown.ca_inc.remains>10|fight_remains<10)
actions.st+=/variable,name=starsurge_condition2,value=buff.starweavers_weft.up|astral_power.deficit<variable.passive_asp+action.wrath.energize_amount+(action.starfire.energize_amount+variable.passive_asp)*(buff.eclipse_solar.remains<(gcd.max*3))|talent.astral_communion&cooldown.astral_communion.remains<3|fight_remains<5
actions.st+=/cancel_buff,name=starlord,if=buff.starlord.remains<2&variable.starsurge_condition2
actions.st+=/starsurge,if=variable.starsurge_condition2
actions.st+=/wrath
actions.st+=/run_action_list,name=fallthru

head=benevolent_embersages_casque,id=207254,bonus_id=4795/1808,ilevel=470,gem_id=192988,enchant_id=7052
neck=eye_of_the_rising_flame,id=207163,bonus_id=4795/8782,ilevel=470,gem_id=192961/192961/192961
shoulders=benevolent_embersages_wisdom,id=207252,bonus_id=4795,ilevel=470
back=undulating_sporecloak,id=205025,bonus_id=8960/8840/8836/8902/1537,ilevel=470
chest=benevolent_embersages_robe,id=207257,bonus_id=4795,ilevel=470,enchant_id=6625
wrists=bracers_of_dreadful_maladies,id=159340,bonus_id=4795,ilevel=470,gem_id=192961
hands=fading_chronogrips,id=207903,bonus_id=4795,ilevel=470
waist=benevolent_embersages_sagacious_sash,id=207251,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6904
legs=benevolent_embersages_leggings,id=207253,bonus_id=4795,ilevel=470,enchant_id=6541
feet=toxic_thorn_footwraps,id=193452,bonus_id=8960/8840/8836/8902/1537,ilevel=470
finger1=archdruids_tainted_seal,id=134487,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
finger2=band_of_twisted_bark,id=134531,bonus_id=4795/1808,ilevel=470,gem_id=192961,enchant_id=6556
trinket1=pips_emerald_friendship_badge,id=207168,bonus_id=4795,ilevel=470
trinket2=balefire_branch,id=159630,bonus_id=4795,ilevel=470
main_hand=vakash_the_shadowed_inferno,id=207788,bonus_id=4795,ilevel=470,enchant_id=6655
off_hand=tricksters_captivating_chime,id=207796,bonus_id=4795,ilevel=470

# Gear Summary
# gear_ilvl=470.00
# gear_stamina=31271
# gear_intellect=10246
# gear_crit_rating=2907
# gear_haste_rating=3817
# gear_mastery_rating=7080
# gear_versatility_rating=793
# gear_armor=4652
# set_bonus=tier31_2pc=1
# set_bonus=tier31_4pc=1

Simulation & Raid Information

Iterations: 22007
Threads: 32
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 905147825
Max Event Queue: 78
Sim Seconds: 6601088
CPU Seconds: 755.2730
Physical Seconds: 30.9335
Speed Up: 8740

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
447 T30 4p 447 T30 4p astral_smolder ticks -394061 2856143 9520 22.53 25355 0 60.1 112.7 0.0% 0.0% 0.0% 0.0% 4.91sec 2856143 300.31sec
447 T30 4p 447 T30 4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
447 T30 4p 447 T30 4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.96sec 0 300.31sec
447 T30 4p 447 T30 4p fey_missile 188046 1545525 5146 29.50 8240 16455 148.5 147.6 27.1% 0.0% 0.0% 0.0% 1.79sec 1545525 300.31sec
447 T30 4p 447 T30 4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
447 T30 4p 447 T30 4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
447 T30 4p 447 T30 4p hungering_shadowflame 424324 905408 3015 3.42 41505 83254 17.1 17.1 27.2% 0.0% 0.0% 0.0% 17.03sec 905408 300.31sec
447 T30 4p 447 T30 4p hungering_shadowflame_self 424324 521084 1735 3.42 23900 47783 17.1 17.1 27.3% 0.0% 0.0% 0.0% 17.03sec 588817 300.31sec
447 T30 4p 447 T30 4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 180.93sec 0 300.31sec
447 T30 4p 447 T30 4p launched_thorns 379403 862822 2873 6.76 20058 40087 33.9 33.8 27.2% 0.0% 0.0% 0.0% 8.73sec 862822 300.31sec
447 T30 4p 447 T30 4p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 75.37sec 0 300.31sec
447 T30 4p 447 T30 4p moonfire 8921 176682 588 2.87 9046 18412 14.3 14.3 34.9% 0.0% 0.0% 0.0% 21.63sec 3588941 300.31sec
447 T30 4p 447 T30 4p moonfire ticks -8921 3412258 11374 61.51 8099 16752 14.3 307.6 34.6% 0.0% 0.0% 0.0% 21.63sec 3588941 300.31sec
447 T30 4p 447 T30 4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
447 T30 4p 447 T30 4p moons_talent 274281 0 0 0.00 0 0 16.9 0.0 0.0% 0.0% 0.0% 0.0% 18.04sec 0 300.31sec
447 T30 4p 447 T30 4p full_moon 274283 1749326 5825 1.05 229419 457864 5.3 5.2 45.7% 0.0% 0.0% 0.0% 63.58sec 1749326 300.31sec
447 T30 4p 447 T30 4p new_moon 274281 1329668 4428 1.19 147455 309449 6.0 5.9 47.0% 0.0% 0.0% 0.0% 53.85sec 1329668 300.31sec
447 T30 4p 447 T30 4p half_moon 274282 1762222 5868 1.13 203645 408790 5.7 5.6 52.8% 0.0% 0.0% 0.0% 57.62sec 1762222 300.31sec
447 T30 4p 447 T30 4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 300.31sec
447 T30 4p 447 T30 4p overwhelming_rage ticks -374037 592134 1974 3.94 30027 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.73sec 668647 300.31sec
447 T30 4p 447 T30 4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.59sec 0 300.31sec
447 T30 4p 447 T30 4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
447 T30 4p 447 T30 4p shooting_stars_moonfire 202497 1628859 5424 14.83 14947 31099 74.4 74.2 43.4% 0.0% 0.0% 0.0% 4.00sec 1628859 300.31sec
447 T30 4p 447 T30 4p shooting_stars_sunfire 202497 1631342 5432 14.87 14927 31056 74.6 74.4 43.3% 0.0% 0.0% 0.0% 4.03sec 1631342 300.31sec
447 T30 4p 447 T30 4p orbit_breaker 274283 1150218 3830 1.24 125856 262573 6.2 6.2 43.8% 0.0% 0.0% 0.0% 49.00sec 1150218 300.31sec
447 T30 4p 447 T30 4p crashing_star 408310 3040605 10125 7.43 55728 115971 37.3 37.2 43.3% 0.0% 0.0% 0.0% 7.90sec 3040605 300.31sec
447 T30 4p 447 T30 4p starfire 194153 687091 2288 4.77 20626 41000 22.9 23.9 39.9% 0.0% 0.0% 0.0% 11.27sec 687091 300.31sec
447 T30 4p 447 T30 4p starsurge 78674 16624632 55359 22.70 101661 210087 113.9 113.6 41.2% 0.0% 0.0% 0.0% 2.63sec 16624632 300.31sec
447 T30 4p 447 T30 4p goldrinns_fang 394047 5848964 19477 7.48 106962 220534 37.6 37.4 43.4% 0.0% 0.0% 0.0% 7.92sec 5848964 300.31sec
447 T30 4p 447 T30 4p sunfire 93402 211843 705 3.48 8807 17785 17.4 17.4 37.5% 0.0% 0.0% 0.0% 18.04sec 3524564 300.31sec
447 T30 4p 447 T30 4p sunfire ticks -93402 3312721 11042 61.70 7796 15792 17.4 308.5 36.8% 0.0% 0.0% 0.0% 18.04sec 3524564 300.31sec
447 T30 4p 447 T30 4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.20sec 0 300.31sec
447 T30 4p 447 T30 4p denizen_of_the_flame 426486 500360 1666 1.69 46333 92580 8.5 8.5 27.5% 0.0% 0.0% 0.0% 32.20sec 500360 300.31sec
447 T30 4p 447 T30 4p denizen_of_the_flame_secondary 426431 460261 1533 3.28 22034 44037 16.4 16.4 27.2% 0.0% 0.0% 0.0% 15.57sec 460261 300.31sec
447 T30 4p 447 T30 4p warrior_of_elune 202425 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 53.03sec 0 300.31sec
447 T30 4p 447 T30 4p wrath 190984 4693443 15629 22.06 28872 58676 110.7 110.4 45.8% 0.0% 0.0% 0.0% 2.65sec 4693443 300.31sec
447+460 2p_2p 447+460 2p_2p astral_smolder ticks -394061 3599066 11997 23.29 30901 0 64.0 116.5 0.0% 0.0% 0.0% 0.0% 4.68sec 3599066 299.79sec
447+460 2p_2p 447+460 2p_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.78sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p fey_missile 188046 1579421 5268 29.62 8383 16749 148.9 148.0 27.3% 0.0% 0.0% 0.0% 1.78sec 1579421 299.79sec
447+460 2p_2p 447+460 2p_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p hungering_shadowflame 424324 907794 3028 3.43 41514 83187 17.2 17.2 27.4% 0.0% 0.0% 0.0% 16.76sec 907794 299.79sec
447+460 2p_2p 447+460 2p_2p hungering_shadowflame_self 424324 522089 1742 3.43 23900 47784 17.2 17.2 27.4% 0.0% 0.0% 0.0% 16.76sec 589953 299.79sec
447+460 2p_2p 447+460 2p_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.31sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p launched_thorns 379403 863556 2881 6.77 20057 40089 33.9 33.8 27.4% 0.0% 0.0% 0.0% 8.72sec 863556 299.79sec
447+460 2p_2p 447+460 2p_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 82.38sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p moonfire 8921 177143 591 2.87 9131 18553 14.3 14.3 34.3% 0.0% 0.0% 0.0% 21.61sec 3665200 299.79sec
447+460 2p_2p 447+460 2p_2p moonfire ticks -8921 3488057 11627 61.66 8232 17056 14.3 308.3 34.9% 0.0% 0.0% 0.0% 21.61sec 3665200 299.79sec
447+460 2p_2p 447+460 2p_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 18.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p full_moon 274283 1799694 6003 1.05 236535 467866 5.3 5.3 45.8% 0.0% 0.0% 0.0% 63.23sec 1799694 299.79sec
447+460 2p_2p 447+460 2p_2p new_moon 274281 1354588 4518 1.19 148405 312912 6.0 6.0 47.9% 0.0% 0.0% 0.0% 53.61sec 1354588 299.79sec
447+460 2p_2p 447+460 2p_2p half_moon 274282 1822988 6081 1.13 210339 419825 5.7 5.6 53.9% 0.0% 0.0% 0.0% 58.00sec 1822988 299.79sec
447+460 2p_2p 447+460 2p_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p overwhelming_rage ticks -374037 606156 2021 3.94 30790 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.31sec 684427 299.79sec
447+460 2p_2p 447+460 2p_2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.14sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p shooting_stars_moonfire 202497 2102600 7014 18.81 15202 31621 94.2 94.0 43.7% 0.0% 0.0% 0.0% 3.16sec 2102600 299.79sec
447+460 2p_2p 447+460 2p_2p shooting_stars_sunfire 202497 2107892 7031 18.88 15180 31584 94.6 94.3 43.7% 0.0% 0.0% 0.0% 3.16sec 2107892 299.79sec
447+460 2p_2p 447+460 2p_2p orbit_breaker 274283 1182575 3945 1.25 128121 266405 6.3 6.3 43.8% 0.0% 0.0% 0.0% 48.19sec 1182575 299.79sec
447+460 2p_2p 447+460 2p_2p starfire 194153 1487224 4961 5.41 39168 78277 26.0 27.0 40.5% 0.0% 0.0% 0.0% 11.47sec 1487224 299.79sec
447+460 2p_2p 447+460 2p_2p starsurge 78674 17136244 57161 22.96 103405 213785 115.0 114.7 41.6% 0.0% 0.0% 0.0% 2.59sec 17136244 299.79sec
447+460 2p_2p 447+460 2p_2p goldrinns_fang 394047 6012021 20054 7.56 108821 224340 37.9 37.8 43.7% 0.0% 0.0% 0.0% 7.76sec 6012021 299.79sec
447+460 2p_2p 447+460 2p_2p sunfire 93402 216315 722 3.48 8953 18091 17.4 17.4 38.2% 0.0% 0.0% 0.0% 18.04sec 3610974 299.79sec
447+460 2p_2p 447+460 2p_2p sunfire ticks -93402 3394659 11316 61.85 7942 16091 17.4 309.2 37.3% 0.0% 0.0% 0.0% 18.04sec 3610974 299.79sec
447+460 2p_2p 447+460 2p_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.42sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p denizen_of_the_flame 426486 501227 1672 1.70 46339 92611 8.5 8.5 27.5% 0.0% 0.0% 0.0% 32.42sec 501227 299.79sec
447+460 2p_2p 447+460 2p_2p denizen_of_the_flame_secondary 426431 461384 1539 3.29 22036 44042 16.4 16.4 27.3% 0.0% 0.0% 0.0% 15.69sec 461384 299.79sec
447+460 2p_2p 447+460 2p_2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.26sec 0 299.79sec
447+460 2p_2p 447+460 2p_2p wrath 190984 5330459 17781 22.99 31172 64138 115.3 114.9 46.2% 0.0% 0.0% 0.0% 2.54sec 5330459 299.79sec
447+470 2p_2p 447+470 2p_2p astral_smolder ticks -394061 3656468 12188 23.33 31342 0 64.3 116.7 0.0% 0.0% 0.0% 0.0% 4.60sec 3656468 299.98sec
447+470 2p_2p 447+470 2p_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.80sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p fey_missile 188046 1606765 5356 29.74 8481 16938 149.6 148.7 27.5% 0.0% 0.0% 0.0% 1.72sec 1606765 299.98sec
447+470 2p_2p 447+470 2p_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p hungering_shadowflame 424324 914110 3047 3.45 41441 83404 17.2 17.2 27.6% 0.0% 0.0% 0.0% 17.02sec 914110 299.98sec
447+470 2p_2p 447+470 2p_2p hungering_shadowflame_self 424324 525697 1752 3.45 23900 47785 17.2 17.2 27.6% 0.0% 0.0% 0.0% 17.02sec 594036 299.98sec
447+470 2p_2p 447+470 2p_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.83sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p launched_thorns 379403 866582 2889 6.78 20055 40085 34.0 33.9 27.6% 0.0% 0.0% 0.0% 8.60sec 866582 299.98sec
447+470 2p_2p 447+470 2p_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 69.07sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p moonfire 8921 179561 599 2.87 9238 18785 14.3 14.3 34.4% 0.0% 0.0% 0.0% 21.61sec 3716422 299.98sec
447+470 2p_2p 447+470 2p_2p moonfire ticks -8921 3536861 11790 61.75 8329 17248 14.3 308.7 35.1% 0.0% 0.0% 0.0% 21.61sec 3716422 299.98sec
447+470 2p_2p 447+470 2p_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.97sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p full_moon 274283 1825390 6085 1.05 239605 472987 5.3 5.3 46.2% 0.0% 0.0% 0.0% 63.02sec 1825390 299.98sec
447+470 2p_2p 447+470 2p_2p new_moon 274281 1365625 4552 1.19 149954 316282 6.0 6.0 47.4% 0.0% 0.0% 0.0% 53.65sec 1365625 299.98sec
447+470 2p_2p 447+470 2p_2p half_moon 274282 1851543 6172 1.13 212944 425300 5.7 5.6 54.2% 0.0% 0.0% 0.0% 57.80sec 1851543 299.98sec
447+470 2p_2p 447+470 2p_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.33sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p overwhelming_rage ticks -374037 617289 2058 3.92 31458 0 4.0 19.6 0.0% 0.0% 0.0% 0.0% 59.60sec 697006 299.98sec
447+470 2p_2p 447+470 2p_2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.25sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p shooting_stars_moonfire 202497 2134599 7116 18.83 15393 32002 94.4 94.1 43.8% 0.0% 0.0% 0.0% 3.16sec 2134599 299.98sec
447+470 2p_2p 447+470 2p_2p shooting_stars_sunfire 202497 2136929 7124 18.87 15371 31969 94.6 94.3 43.9% 0.0% 0.0% 0.0% 3.17sec 2136929 299.98sec
447+470 2p_2p 447+470 2p_2p orbit_breaker 274283 1203511 4012 1.26 129559 269771 6.3 6.3 44.3% 0.0% 0.0% 0.0% 48.26sec 1203511 299.98sec
447+470 2p_2p 447+470 2p_2p starfire 194153 1506801 5023 5.41 39664 79195 26.1 27.1 40.5% 0.0% 0.0% 0.0% 11.46sec 1506801 299.98sec
447+470 2p_2p 447+470 2p_2p starsurge 78674 17388260 57966 22.98 104675 216428 115.1 114.9 41.8% 0.0% 0.0% 0.0% 2.59sec 17388260 299.98sec
447+470 2p_2p 447+470 2p_2p goldrinns_fang 394047 6096849 20324 7.56 110138 227181 38.0 37.8 43.8% 0.0% 0.0% 0.0% 7.75sec 6096849 299.98sec
447+470 2p_2p 447+470 2p_2p sunfire 93402 219102 730 3.48 9058 18308 17.4 17.4 38.2% 0.0% 0.0% 0.0% 18.05sec 3662496 299.98sec
447+470 2p_2p 447+470 2p_2p sunfire ticks -93402 3443394 11478 61.94 8035 16277 17.4 309.7 37.4% 0.0% 0.0% 0.0% 18.05sec 3662496 299.98sec
447+470 2p_2p 447+470 2p_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.66sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p denizen_of_the_flame 426486 500511 1669 1.69 46336 92592 8.5 8.5 27.6% 0.0% 0.0% 0.0% 32.66sec 500511 299.98sec
447+470 2p_2p 447+470 2p_2p denizen_of_the_flame_secondary 426431 460903 1536 3.28 22035 44041 16.4 16.4 27.5% 0.0% 0.0% 0.0% 15.79sec 460903 299.98sec
447+470 2p_2p 447+470 2p_2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.34sec 0 299.98sec
447+470 2p_2p 447+470 2p_2p wrath 190984 5407015 18025 23.02 31517 64876 115.5 115.1 46.3% 0.0% 0.0% 0.0% 2.54sec 5407015 299.98sec
460 T31_2p 460 T31_2p astral_smolder ticks -394061 3675606 12252 23.28 31576 0 64.1 116.4 0.0% 0.0% 0.0% 0.0% 4.67sec 3675606 299.84sec
460 T31_2p 460 T31_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.84sec
460 T31_2p 460 T31_2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.14sec 0 299.84sec
460 T31_2p 460 T31_2p fey_missile 188046 1617944 5396 29.72 8560 17098 149.5 148.5 27.3% 0.0% 0.0% 0.0% 1.75sec 1617944 299.84sec
460 T31_2p 460 T31_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.84sec
460 T31_2p 460 T31_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.84sec
460 T31_2p 460 T31_2p hungering_shadowflame 424324 905974 3022 3.44 41490 82771 17.2 17.2 27.3% 0.0% 0.0% 0.0% 16.95sec 905974 299.84sec
460 T31_2p 460 T31_2p hungering_shadowflame_self 424324 523238 1745 3.44 23919 47823 17.2 17.2 27.4% 0.0% 0.0% 0.0% 16.95sec 591957 299.84sec
460 T31_2p 460 T31_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.57sec 0 299.84sec
460 T31_2p 460 T31_2p launched_thorns 379403 867764 2894 6.78 20097 40165 34.0 33.9 27.4% 0.0% 0.0% 0.0% 8.64sec 867764 299.84sec
460 T31_2p 460 T31_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 61.22sec 0 299.84sec
460 T31_2p 460 T31_2p moonfire 8921 150992 504 2.87 7770 15809 14.3 14.3 34.4% 0.0% 0.0% 0.0% 21.60sec 3124837 299.84sec
460 T31_2p 460 T31_2p moonfire ticks -8921 2973844 9913 61.79 7005 14510 14.3 308.9 34.9% 0.0% 0.0% 0.0% 21.60sec 3124837 299.84sec
460 T31_2p 460 T31_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.84sec
460 T31_2p 460 T31_2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.97sec 0 299.84sec
460 T31_2p 460 T31_2p full_moon 274283 1842196 6144 1.05 241974 477999 5.3 5.3 45.9% 0.0% 0.0% 0.0% 63.11sec 1842196 299.84sec
460 T31_2p 460 T31_2p new_moon 274281 1375359 4587 1.19 151078 318765 6.0 6.0 47.3% 0.0% 0.0% 0.0% 53.60sec 1375359 299.84sec
460 T31_2p 460 T31_2p half_moon 274282 1868132 6230 1.13 215145 429563 5.7 5.6 54.1% 0.0% 0.0% 0.0% 57.85sec 1868132 299.84sec
460 T31_2p 460 T31_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.30sec 0 299.84sec
460 T31_2p 460 T31_2p overwhelming_rage ticks -374037 628931 2096 3.95 31822 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 57.81sec 711031 299.84sec
460 T31_2p 460 T31_2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 307.11sec 0 299.84sec
460 T31_2p 460 T31_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.84sec
460 T31_2p 460 T31_2p shooting_stars_moonfire 202497 1794925 5986 18.84 12951 26943 94.4 94.1 43.7% 0.0% 0.0% 0.0% 3.17sec 1794925 299.84sec
460 T31_2p 460 T31_2p shooting_stars_sunfire 202497 1800734 6006 18.92 12937 26917 94.8 94.5 43.7% 0.0% 0.0% 0.0% 3.16sec 1800734 299.84sec
460 T31_2p 460 T31_2p orbit_breaker 274283 1214055 4049 1.26 130857 272300 6.3 6.3 44.1% 0.0% 0.0% 0.0% 48.25sec 1214055 299.84sec
460 T31_2p 460 T31_2p starfire 194153 1518710 5065 5.42 39988 79983 26.1 27.1 40.3% 0.0% 0.0% 0.0% 11.49sec 1518710 299.84sec
460 T31_2p 460 T31_2p starsurge 78674 17559331 58563 23.01 105672 218556 115.2 115.0 41.7% 0.0% 0.0% 0.0% 2.59sec 17559331 299.84sec
460 T31_2p 460 T31_2p goldrinns_fang 394047 6163307 20555 7.58 111229 229284 38.0 37.9 43.7% 0.0% 0.0% 0.0% 7.69sec 6163307 299.84sec
460 T31_2p 460 T31_2p sunfire 93402 184071 614 3.48 7615 15398 17.4 17.4 38.2% 0.0% 0.0% 0.0% 18.04sec 3079038 299.84sec
460 T31_2p 460 T31_2p sunfire ticks -93402 2894968 9650 61.98 6758 13692 17.4 309.9 37.3% 0.0% 0.0% 0.0% 18.04sec 3079038 299.84sec
460 T31_2p 460 T31_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.18sec 0 299.84sec
460 T31_2p 460 T31_2p denizen_of_the_flame 426486 502111 1675 1.70 46429 92780 8.5 8.5 27.4% 0.0% 0.0% 0.0% 31.18sec 502111 299.84sec
460 T31_2p 460 T31_2p denizen_of_the_flame_secondary 426431 463063 1544 3.30 22080 44129 16.5 16.5 27.4% 0.0% 0.0% 0.0% 15.16sec 463063 299.84sec
460 T31_2p 460 T31_2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.44sec 0 299.84sec
460 T31_2p 460 T31_2p wrath 190984 5454892 18193 23.06 31820 65450 115.6 115.2 46.2% 0.0% 0.0% 0.0% 2.53sec 5454892 299.84sec
460 T31_4p 460 T31_4p astral_smolder ticks -394061 4270256 14234 23.28 36688 0 64.0 116.4 0.0% 0.0% 0.0% 0.0% 4.60sec 4270256 299.90sec
460 T31_4p 460 T31_4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
460 T31_4p 460 T31_4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.60sec 0 299.90sec
460 T31_4p 460 T31_4p fey_missile 188046 1900995 6339 29.80 10027 20027 149.9 149.0 27.3% 0.0% 0.0% 0.0% 1.71sec 1900995 299.90sec
460 T31_4p 460 T31_4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
460 T31_4p 460 T31_4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
460 T31_4p 460 T31_4p hungering_shadowflame 424324 910106 3035 3.44 41376 83209 17.2 17.2 27.5% 0.0% 0.0% 0.0% 16.72sec 910106 299.90sec
460 T31_4p 460 T31_4p hungering_shadowflame_self 424324 524769 1750 3.44 23911 47808 17.2 17.2 27.5% 0.0% 0.0% 0.0% 16.72sec 593383 299.90sec
460 T31_4p 460 T31_4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.01sec 0 299.90sec
460 T31_4p 460 T31_4p launched_thorns 379403 866480 2889 6.78 20081 40133 34.0 33.9 27.3% 0.0% 0.0% 0.0% 8.69sec 866480 299.90sec
460 T31_4p 460 T31_4p launched_thorns_heal 379407 0 0 0.00 0 0 0.7 0.0 0.0% 0.0% 0.0% 0.0% 68.94sec 0 299.90sec
460 T31_4p 460 T31_4p moonfire 8921 155253 518 2.87 7961 16319 14.3 14.3 34.3% 0.0% 0.0% 0.0% 21.60sec 3222150 299.90sec
460 T31_4p 460 T31_4p moonfire ticks -8921 3066897 10223 61.74 7197 15030 14.3 308.7 35.0% 0.0% 0.0% 0.0% 21.60sec 3222150 299.90sec
460 T31_4p 460 T31_4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
460 T31_4p 460 T31_4p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.96sec 0 299.90sec
460 T31_4p 460 T31_4p full_moon 274283 2043214 6813 1.05 269234 528695 5.3 5.3 46.0% 0.0% 0.0% 0.0% 63.25sec 2043214 299.90sec
460 T31_4p 460 T31_4p new_moon 274281 1544151 5149 1.19 170933 356439 6.0 6.0 47.4% 0.0% 0.0% 0.0% 53.57sec 1544151 299.90sec
460 T31_4p 460 T31_4p half_moon 274282 2029727 6768 1.13 234511 466174 5.7 5.6 54.0% 0.0% 0.0% 0.0% 57.72sec 2029727 299.90sec
460 T31_4p 460 T31_4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.32sec 0 299.90sec
460 T31_4p 460 T31_4p overwhelming_rage ticks -374037 618232 2061 3.95 31339 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 58.92sec 698555 299.90sec
460 T31_4p 460 T31_4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 308.20sec 0 299.90sec
460 T31_4p 460 T31_4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.90sec
460 T31_4p 460 T31_4p shooting_stars_moonfire 202497 1942877 6478 18.84 13959 29218 94.4 94.2 43.7% 0.0% 0.0% 0.0% 3.15sec 1942877 299.90sec
460 T31_4p 460 T31_4p shooting_stars_sunfire 202497 1945628 6488 18.89 13945 29184 94.7 94.4 43.7% 0.0% 0.0% 0.0% 3.15sec 1945628 299.90sec
460 T31_4p 460 T31_4p orbit_breaker 274283 1311159 4372 1.26 141174 295761 6.3 6.3 43.6% 0.0% 0.0% 0.0% 48.01sec 1311159 299.90sec
460 T31_4p 460 T31_4p starfire 194153 1504378 5016 5.42 39624 79140 26.1 27.1 40.4% 0.0% 0.0% 0.0% 11.46sec 1504378 299.90sec
460 T31_4p 460 T31_4p starsurge 78674 19070545 63590 22.99 115032 237526 115.1 114.9 41.6% 0.0% 0.0% 0.0% 2.59sec 19070545 299.90sec
460 T31_4p 460 T31_4p goldrinns_fang 394047 6686917 22297 7.57 121011 248367 38.0 37.8 43.7% 0.0% 0.0% 0.0% 7.80sec 6686917 299.90sec
460 T31_4p 460 T31_4p sunfire 93402 192578 642 3.48 7967 16131 17.4 17.4 38.1% 0.0% 0.0% 0.0% 18.04sec 3229764 299.90sec
460 T31_4p 460 T31_4p sunfire ticks -93402 3037186 10124 61.94 7094 14377 17.4 309.7 37.3% 0.0% 0.0% 0.0% 18.04sec 3229764 299.90sec
460 T31_4p 460 T31_4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 32.35sec 0 299.90sec
460 T31_4p 460 T31_4p denizen_of_the_flame 426486 502746 1676 1.70 46389 92722 8.5 8.5 27.5% 0.0% 0.0% 0.0% 32.35sec 502746 299.90sec
460 T31_4p 460 T31_4p denizen_of_the_flame_secondary 426431 462442 1542 3.30 22062 44097 16.5 16.5 27.3% 0.0% 0.0% 0.0% 15.70sec 462442 299.90sec
460 T31_4p 460 T31_4p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.46sec 0 299.90sec
460 T31_4p 460 T31_4p wrath 190984 5739911 19140 23.03 33476 69004 115.5 115.1 46.1% 0.0% 0.0% 0.0% 2.54sec 5739911 299.90sec
470 T31_2p 470 T31_2p astral_smolder ticks -394061 3736502 12455 23.32 32038 0 64.4 116.6 0.0% 0.0% 0.0% 0.0% 4.62sec 3736502 299.77sec
470 T31_2p 470 T31_2p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.77sec
470 T31_2p 470 T31_2p denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.92sec 0 299.77sec
470 T31_2p 470 T31_2p fey_missile 188046 1652263 5512 29.96 8664 17302 150.6 149.7 27.5% 0.0% 0.0% 0.0% 1.73sec 1652263 299.77sec
470 T31_2p 470 T31_2p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.77sec
470 T31_2p 470 T31_2p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.77sec
470 T31_2p 470 T31_2p hungering_shadowflame 424324 915197 3053 3.45 41578 83407 17.2 17.2 27.6% 0.0% 0.0% 0.0% 16.71sec 915197 299.77sec
470 T31_2p 470 T31_2p hungering_shadowflame_self 424324 525762 1754 3.45 23920 47821 17.2 17.2 27.6% 0.0% 0.0% 0.0% 16.71sec 594794 299.77sec
470 T31_2p 470 T31_2p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.38sec 0 299.77sec
470 T31_2p 470 T31_2p launched_thorns 379403 870118 2903 6.80 20097 40167 34.1 34.0 27.5% 0.0% 0.0% 0.0% 8.67sec 870118 299.77sec
470 T31_2p 470 T31_2p launched_thorns_heal 379407 0 0 0.00 0 0 0.6 0.0 0.0% 0.0% 0.0% 0.0% 67.15sec 0 299.77sec
470 T31_2p 470 T31_2p moonfire 8921 152821 510 2.87 7862 16005 14.3 14.3 34.4% 0.0% 0.0% 0.0% 21.60sec 3167421 299.77sec
470 T31_2p 470 T31_2p moonfire ticks -8921 3014599 10049 61.86 7086 14673 14.3 309.3 35.1% 0.0% 0.0% 0.0% 21.60sec 3167421 299.77sec
470 T31_2p 470 T31_2p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.77sec
470 T31_2p 470 T31_2p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.94sec 0 299.77sec
470 T31_2p 470 T31_2p full_moon 274283 1871883 6244 1.05 245242 484548 5.3 5.3 46.3% 0.0% 0.0% 0.0% 63.09sec 1871883 299.77sec
470 T31_2p 470 T31_2p new_moon 274281 1395645 4656 1.19 152600 321663 6.0 6.0 48.1% 0.0% 0.0% 0.0% 53.50sec 1395645 299.77sec
470 T31_2p 470 T31_2p half_moon 274282 1891352 6309 1.13 217792 434742 5.7 5.6 54.0% 0.0% 0.0% 0.0% 57.84sec 1891352 299.77sec
470 T31_2p 470 T31_2p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.34sec 0 299.77sec
470 T31_2p 470 T31_2p overwhelming_rage ticks -374037 644370 2148 3.97 32488 0 4.1 19.8 0.0% 0.0% 0.0% 0.0% 59.39sec 728510 299.77sec
470 T31_2p 470 T31_2p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.94sec 0 299.77sec
470 T31_2p 470 T31_2p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.77sec
470 T31_2p 470 T31_2p shooting_stars_moonfire 202497 1824861 6088 18.89 13113 27287 94.7 94.4 43.9% 0.0% 0.0% 0.0% 3.14sec 1824861 299.77sec
470 T31_2p 470 T31_2p shooting_stars_sunfire 202497 1825804 6091 18.94 13100 27252 94.9 94.6 43.8% 0.0% 0.0% 0.0% 3.15sec 1825804 299.77sec
470 T31_2p 470 T31_2p orbit_breaker 274283 1231365 4108 1.26 132419 276020 6.3 6.3 44.0% 0.0% 0.0% 0.0% 47.94sec 1231365 299.77sec
470 T31_2p 470 T31_2p starfire 194153 1537210 5128 5.42 40487 80819 26.1 27.1 40.5% 0.0% 0.0% 0.0% 11.47sec 1537210 299.77sec
470 T31_2p 470 T31_2p starsurge 78674 17808808 59408 23.04 106950 221240 115.4 115.1 41.8% 0.0% 0.0% 0.0% 2.58sec 17808808 299.77sec
470 T31_2p 470 T31_2p goldrinns_fang 394047 6254486 20864 7.59 112533 232134 38.1 37.9 43.9% 0.0% 0.0% 0.0% 7.77sec 6254486 299.77sec
470 T31_2p 470 T31_2p sunfire 93402 186232 621 3.48 7701 15576 17.4 17.4 38.3% 0.0% 0.0% 0.0% 18.04sec 3121797 299.77sec
470 T31_2p 470 T31_2p sunfire ticks -93402 2935565 9785 62.05 6837 13847 17.4 310.3 37.4% 0.0% 0.0% 0.0% 18.04sec 3121797 299.77sec
470 T31_2p 470 T31_2p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.5 0.0 0.0% 0.0% 0.0% 0.0% 31.80sec 0 299.77sec
470 T31_2p 470 T31_2p denizen_of_the_flame 426486 502867 1678 1.70 46426 92779 8.5 8.5 27.5% 0.0% 0.0% 0.0% 31.80sec 502867 299.77sec
470 T31_2p 470 T31_2p denizen_of_the_flame_secondary 426431 463442 1546 3.30 22078 44124 16.5 16.5 27.5% 0.0% 0.0% 0.0% 15.45sec 463442 299.77sec
470 T31_2p 470 T31_2p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.47sec 0 299.77sec
470 T31_2p 470 T31_2p wrath 190984 5533327 18459 23.10 32174 66214 115.9 115.4 46.3% 0.0% 0.0% 0.0% 2.53sec 5533327 299.77sec
470 T31_4p 470 T31_4p astral_smolder ticks -394061 4386750 14623 23.36 37560 0 64.5 116.8 0.0% 0.0% 0.0% 0.0% 4.60sec 4386750 300.07sec
470 T31_4p 470 T31_4p augmentation 393438 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
470 T31_4p 470 T31_4p denizen_of_the_dream 394065 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 32.32sec 0 300.07sec
470 T31_4p 470 T31_4p fey_missile 188046 1955423 6517 29.95 10245 20465 150.7 149.8 27.5% 0.0% 0.0% 0.0% 1.75sec 1955423 300.07sec
470 T31_4p 470 T31_4p flask 374000 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
470 T31_4p 470 T31_4p food 396092 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
470 T31_4p 470 T31_4p hungering_shadowflame 424324 914502 3048 3.44 41619 83278 17.2 17.2 27.5% 0.0% 0.0% 0.0% 16.98sec 914502 300.07sec
470 T31_4p 470 T31_4p hungering_shadowflame_self 424324 525380 1751 3.44 23920 47826 17.2 17.2 27.5% 0.0% 0.0% 0.0% 16.98sec 594420 300.07sec
470 T31_4p 470 T31_4p incarnation_chosen_of_elune 102560 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.33sec 0 300.07sec
470 T31_4p 470 T31_4p launched_thorns 379403 870968 2903 6.80 20099 40173 34.1 34.0 27.5% 0.0% 0.0% 0.0% 8.64sec 870968 300.07sec
470 T31_4p 470 T31_4p launched_thorns_heal 379407 0 0 0.00 0 0 0.6 0.0 0.0% 0.0% 0.0% 0.0% 78.16sec 0 300.07sec
470 T31_4p 470 T31_4p moonfire 8921 158919 530 2.87 8138 16666 14.3 14.3 34.4% 0.0% 0.0% 0.0% 21.61sec 3303184 300.07sec
470 T31_4p 470 T31_4p moonfire ticks -8921 3144265 10481 61.92 7351 15343 14.3 309.6 35.1% 0.0% 0.0% 0.0% 21.61sec 3303184 300.07sec
470 T31_4p 470 T31_4p moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
470 T31_4p 470 T31_4p moons_talent 274281 0 0 0.00 0 0 17.0 0.0 0.0% 0.0% 0.0% 0.0% 17.97sec 0 300.07sec
470 T31_4p 470 T31_4p full_moon 274283 2104868 7015 1.05 275917 541764 5.3 5.3 46.6% 0.0% 0.0% 0.0% 63.20sec 2104868 300.07sec
470 T31_4p 470 T31_4p new_moon 274281 1580352 5267 1.19 174211 362415 6.0 6.0 48.0% 0.0% 0.0% 0.0% 53.68sec 1580352 300.07sec
470 T31_4p 470 T31_4p half_moon 274282 2080073 6932 1.13 239702 477323 5.7 5.6 54.1% 0.0% 0.0% 0.0% 57.98sec 2080073 300.07sec
470 T31_4p 470 T31_4p natures_vigil 124974 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 90.32sec 0 300.07sec
470 T31_4p 470 T31_4p overwhelming_rage ticks -374037 640042 2133 3.94 32487 0 4.1 19.7 0.0% 0.0% 0.0% 0.0% 59.23sec 723646 300.07sec
470 T31_4p 470 T31_4p potion 371028 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 306.73sec 0 300.07sec
470 T31_4p 470 T31_4p shooting_stars 202342 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.07sec
470 T31_4p 470 T31_4p shooting_stars_moonfire 202497 1995172 6649 18.88 14283 29880 94.7 94.4 43.9% 0.0% 0.0% 0.0% 3.15sec 1995172 300.07sec
470 T31_4p 470 T31_4p shooting_stars_sunfire 202497 1997605 6657 18.94 14263 29851 95.0 94.7 43.8% 0.0% 0.0% 0.0% 3.15sec 1997605 300.07sec
470 T31_4p 470 T31_4p orbit_breaker 274283 1347023 4489 1.26 144494 301724 6.3 6.3 44.1% 0.0% 0.0% 0.0% 48.04sec 1347023 300.07sec
470 T31_4p 470 T31_4p starfire 194153 1540037 5132 5.42 40510 80779 26.1 27.1 40.5% 0.0% 0.0% 0.0% 11.46sec 1540037 300.07sec
470 T31_4p 470 T31_4p starsurge 78674 19578413 65246 23.04 117623 242821 115.5 115.2 41.8% 0.0% 0.0% 0.0% 2.59sec 19578413 300.07sec
470 T31_4p 470 T31_4p goldrinns_fang 394047 6866255 22882 7.59 123749 253739 38.1 38.0 44.0% 0.0% 0.0% 0.0% 7.79sec 6866255 300.07sec
470 T31_4p 470 T31_4p sunfire 93402 197338 658 3.48 8140 16462 17.4 17.4 38.5% 0.0% 0.0% 0.0% 18.05sec 3313116 300.07sec
470 T31_4p 470 T31_4p sunfire ticks -93402 3115778 10386 62.11 7247 14686 17.4 310.5 37.5% 0.0% 0.0% 0.0% 18.05sec 3313116 300.07sec
470 T31_4p 470 T31_4p tindrals_fowl_fantasia 426341 0 0 0.00 0 0 8.6 0.0 0.0% 0.0% 0.0% 0.0% 31.67sec 0 300.07sec
470 T31_4p 470 T31_4p denizen_of_the_flame 426486 506389 1688 1.71 46435 92796 8.6 8.6 27.6% 0.0% 0.0% 0.0% 31.67sec 506389 300.07sec
470 T31_4p 470 T31_4p denizen_of_the_flame_secondary 426431 466194 1554 3.31 22083 44134 16.6 16.6 27.5% 0.0% 0.0% 0.0% 15.30sec 466194 300.07sec
470 T31_4p 470 T31_4p warrior_of_elune 202425 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 48.46sec 0 300.07sec
470 T31_4p 470 T31_4p wrath 190984 5888450 19624 23.10 34193 70427 115.9 115.5 46.3% 0.0% 0.0% 0.0% 2.53sec 5888450 300.07sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
176872.8 0.0 Health 0.00% 0.0 100.0% 100%

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Waning Twilight 5.7 0.0 54.0s 54.0s 48.2s 91.18% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447 T30 4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 346.8s
  • trigger_min/max:6.1s / 346.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 358.5s
  • uptime_min/max:70.05% / 99.74%

Stack Uptimes

  • waning_twilight_1:91.18%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.2s 55.2s 49.9s 92.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+470 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 336.3s
  • trigger_min/max:6.4s / 336.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 345.2s
  • uptime_min/max:71.37% / 99.73%

Stack Uptimes

  • waning_twilight_1:92.37%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.0s 55.1s 49.7s 92.36% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:447+460 2p_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 344.1s
  • trigger_min/max:6.1s / 344.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 336.2s
  • uptime_min/max:71.35% / 99.70%

Stack Uptimes

  • waning_twilight_1:92.36%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.5 0.0 55.1s 55.1s 49.9s 92.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 334.9s
  • trigger_min/max:6.1s / 334.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 339.8s
  • uptime_min/max:68.92% / 99.72%

Stack Uptimes

  • waning_twilight_1:92.39%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 54.7s 54.8s 49.5s 92.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_2p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 335.2s
  • trigger_min/max:6.1s / 335.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 341.6s
  • uptime_min/max:70.82% / 99.73%

Stack Uptimes

  • waning_twilight_1:92.32%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 55.0s 55.0s 49.9s 92.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:470 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 329.8s
  • trigger_min/max:6.1s / 329.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 349.3s
  • uptime_min/max:71.66% / 99.73%

Stack Uptimes

  • waning_twilight_1:92.46%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Waning Twilight 5.6 0.0 54.8s 54.8s 49.5s 92.30% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:460 T31_4p
  • cooldown name:buff_waning_twilight
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 328.0s
  • trigger_min/max:6.3s / 328.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 356.4s
  • uptime_min/max:72.81% / 99.74%

Stack Uptimes

  • waning_twilight_1:92.30%

Spelldata

  • id:393957
  • name:Waning Twilight
  • tooltip:Damage and healing from {$@=}auracaster increased by {$=}w1%.
  • description:{$@spelldesc393956=When you have {$s3=3} periodic effects from your spells on a target, your damage and healing on them are increased by {$s1=5}%.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.$?$w3>0[ Stamina increased by $w3%.][]
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by {$s1=5}%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by {$1490s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Wild

Buff Details

  • buff initial source:
  • cooldown name:buff_mark_of_the_wild
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1126
  • name:Mark of the Wild
  • tooltip:Versatility increased by $w1%.
  • description:Infuse a friendly target with the power of the wild, increasing their Versatility by $s1% for 60 minutes. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by {$=}w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by {$=}w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by {$113746s1=5}%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 143247
Mean 299.95
Minimum 240.00
Maximum 360.00
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.6485
5th Percentile 246.05
95th Percentile 354.08
( 95th Percentile - 5th Percentile ) 108.03
Mean Distribution
Standard Deviation 0.0915
95.00% Confidence Interval ( 299.77 - 300.13 )
Normalized 95.00% Confidence Interval ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 513
0.1% Error 51258
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 41
0.01 Scale Factor Error with Delta=300 1025
DPS
Fluffy_Pillow Damage Per Second
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 143247
Mean 189447.05
Minimum 159575.41
Maximum 237688.92
Spread ( max - min ) 78113.51
Range [ ( max - min ) / 2 * 100% ] 20.62%
Standard Deviation 10232.9379
5th Percentile 174706.59
95th Percentile 208063.46
( 95th Percentile - 5th Percentile ) 33356.87
Mean Distribution
Standard Deviation 27.0369
95.00% Confidence Interval ( 189394.06 - 189500.04 )
Normalized 95.00% Confidence Interval ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11208
0.1 Scale Factor Error with Delta=300 893891
0.05 Scale Factor Error with Delta=300 3575563
0.01 Scale Factor Error with Delta=300 89389055
HPS
Fluffy_Pillow Healing Per Second
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 143247
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 4786
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (73) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 57754899 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 5043 5043 5043
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=73
race=humanoid
role=tank
position=front

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.